From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS06200 [old locus tag: SACOL1210 ]
  • pan locus tag?: SAUPAN003478000
  • symbol: SACOL_RS06200
  • pan gene symbol?: pyrR
  • synonym:
  • product: bifunctional pyrimidine operon transcriptional regulator/uracil phosphoribosyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS06200 [old locus tag: SACOL1210 ]
  • symbol: SACOL_RS06200
  • product: bifunctional pyrimidine operon transcriptional regulator/uracil phosphoribosyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 1217368..1217895
  • length: 528
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1217368..1217895) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGTCTGAACGTATCATAATGGATGATGCCGCAATACAACGTACAGTGACGAGAATCGCT
    CACGAAATTTTGGAGTATAACAAAGGTACTGATAATTTAATTCTTTTAGGTATCAAAACA
    AGAGGTGAATATTTAGCGAATCGTATACAAGATAAAATTCATCAAATTGAGCAACAACGT
    ATACCTACTGGAACAATTGATATTACATACTTTAGAGATGATATAGAGCACATGTCATCA
    CTTACGACAAAAGACGCAATAGACATCGACACAGATATTACAGATAAAGTAGTCATCATT
    ATTGACGATGTGCTGTATACTGGTCGAACGGTTCGTGCTTCACTTGATGCTATTTTGCTA
    AATGCTAGACCTATTAAAATTGGTTTAGCTGCTTTGGTTGATCGAGGACATCGTGAGTTA
    CCAATTCGAGCAGATTTTGTTGGTAAAAATATACCTACTTCTAAAGAGGAAACGGTAAGT
    GTCTATTTAGAAGAAATGGATCAAAGAAATGCAGTTATAATTAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    528

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS06200 [old locus tag: SACOL1210 ]
  • symbol: SACOL_RS06200
  • description: bifunctional pyrimidine operon transcriptional regulator/uracil phosphoribosyltransferase
  • length: 175
  • theoretical pI: 5.08873
  • theoretical MW: 19854.6
  • GRAVY: -0.196

Function[edit source | edit]

  • reaction:
    EC 2.4.2.9?  ExPASy
    Uracil phosphoribosyltransferaseUMP + diphosphate = uracil + 5-phospho-alpha-D-ribose 1-diphosphate
  • TIGRFAM:
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotideshypoxanthine phosphoribosyltransferase (TIGR01203; EC 2.4.2.8; HMM-score: 44.3)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidesadenine phosphoribosyltransferase (TIGR01090; EC 2.4.2.7; HMM-score: 17.1)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisribose-phosphate diphosphokinase (TIGR01251; EC 2.7.6.1; HMM-score: 16.2)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesisorotate phosphoribosyltransferase (TIGR00336; EC 2.4.2.10; HMM-score: 15.2)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesisorotate phosphoribosyltransferase (TIGR01367; EC 2.4.2.10; HMM-score: 13.9)
    Cellular processesCellular processesDNA transformationcomF family protein (TIGR00201; HMM-score: 11.5)
  • TheSEED:
  • PFAM:
    PRTase-like (CL0533) Pribosyltran; Phosphoribosyl transferase domain (PF00156; HMM-score: 68.4)
    PRTase_2; Phosphoribosyl transferase (PF15609; HMM-score: 13.6)
    PRTase_3; PRTase ComF-like (PF15610; HMM-score: 12.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.095
    • Ymax_pos: 21
    • Cmax: 0.129
    • Cmax_pos: 21
    • Smax: 0.138
    • Smax_pos: 19
    • Smean: 0.066
    • D: 0.083
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 445926015 NCBI
  • RefSeq: WP_000003870 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MSERIIMDDAAIQRTVTRIAHEILEYNKGTDNLILLGIKTRGEYLANRIQDKIHQIEQQRIPTGTIDITYFRDDIEHMSSLTTKDAIDIDTDITDKVVIIIDDVLYTGRTVRASLDAILLNARPIKIGLAALVDRGHRELPIRADFVGKNIPTSKEETVSVYLEEMDQRNAVIIK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS06200 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]