From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS06485 [old locus tag: SACOL1270 ]
  • pan locus tag?: SAUPAN003551000
  • symbol: SACOL_RS06485
  • pan gene symbol?: clpQ
  • synonym:
  • product: HslU--HslV peptidase proteolytic subunit

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS06485 [old locus tag: SACOL1270 ]
  • symbol: SACOL_RS06485
  • product: HslU--HslV peptidase proteolytic subunit
  • replicon: chromosome
  • strand: +
  • coordinates: 1281432..1281977
  • length: 546
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1281432..1281977) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAGTAATACAACATTACATGCAACAACAATTTATGCTGTAAGACATAATGGGAAAGCA
    GCTATGGCTGGAGATGGGCAAGTAACGCTTGGTCAACAAGTCATCATGAAACAAACGGCA
    AGAAAAGTGCGACGTTTATATGAAGGTAAAGTGTTAGCTGGTTTCGCAGGTAGTGTAGCA
    GATGCGTTTACGTTATTTGAAAAATTCGAAACAAAATTACAACAGTTTAGTGGTAACTTA
    GAAAGAGCTGCTGTTGAATTGGCACAAGAATGGCGAGGCGATAAACAATTACGTCAATTA
    GAAGCTATGCTAATTGTAATGGATAAAGATGCTATTTTAGTTGTCAGTGGAACTGGCGAA
    GTTATTGCTCCAGATGATGACCTTATCGCTATTGGATCAGGAGGCAACTACGCATTAAGC
    GCAGGACGTGCATTGAAACGCCATGCATCGCATTTGTCTGCTGAAGAAATGGCATATGAG
    AGCTTGAAAGTAGCGGCTGATATTTGTGTCTTTACCAACGATAATATTGTTGTCGAAACA
    CTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    546

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS06485 [old locus tag: SACOL1270 ]
  • symbol: SACOL_RS06485
  • description: HslU--HslV peptidase proteolytic subunit
  • length: 181
  • theoretical pI: 6.11631
  • theoretical MW: 19572.2
  • GRAVY: -0.0154696

Function[edit source | edit]

  • reaction:
    EC 3.4.25.2?  ExPASy
    HslU--HslV peptidaseATP-dependent cleavage of peptide bonds with broad specificity
  • TIGRFAM:
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidesATP-dependent protease HslVU, peptidase subunit (TIGR03692; EC 3.4.25.2; HMM-score: 276.6)
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidesproteasome endopeptidase complex, archaeal, beta subunit (TIGR03634; EC 3.4.25.1; HMM-score: 29.2)
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidesproteasome, beta subunit (TIGR03690; EC 3.4.25.1; HMM-score: 25.9)
  • TheSEED:
  • PFAM:
    NTN (CL0052) Proteasome; Proteasome subunit (PF00227; HMM-score: 95.7)
    NADP_Rossmann (CL0063) Pyr_redox_2; Pyridine nucleotide-disulphide oxidoreductase (PF07992; HMM-score: 15.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.241
    • Ymax_pos: 24
    • Cmax: 0.225
    • Cmax_pos: 24
    • Smax: 0.472
    • Smax_pos: 20
    • Smean: 0.23
    • D: 0.237
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 445994826 NCBI
  • RefSeq: WP_000072681 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MSNTTLHATTIYAVRHNGKAAMAGDGQVTLGQQVIMKQTARKVRRLYEGKVLAGFAGSVADAFTLFEKFETKLQQFSGNLERAAVELAQEWRGDKQLRQLEAMLIVMDKDAILVVSGTGEVIAPDDDLIAIGSGGNYALSAGRALKRHASHLSAEEMAYESLKVAADICVFTNDNIVVETL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS06485 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]