From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS06535 [old locus tag: SACOL1280 ]
  • pan locus tag?: SAUPAN003562000
  • symbol: SACOL_RS06535
  • pan gene symbol?: cdsA
  • synonym:
  • product: phosphatidate cytidylyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS06535 [old locus tag: SACOL1280 ]
  • symbol: SACOL_RS06535
  • product: phosphatidate cytidylyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 1289007..1289789
  • length: 783
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1289007..1289789) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGAAAGTTAGAACGCTGACAGCTATTATTGCCTTAATCGTATTCTTGCCTATCTTGTTA
    AAAGGCGGCCTTGTGTTAATGATATTTGCTAATATATTAGCATTGATTGCATTAAAAGAA
    TTGTTGAATATGAATATGATTAAATTTGTTTCAGTTCCTGGTTTAATTAGTGCAGTTGGT
    CTTATCATCATTATGTTGCCACAACATGCAGGGCCATGGGTACAAGTAATTCAATTAAAA
    AGTTTAATTGCAATGAGCTTTATTGTATTAAGTTATACTGTCTTATCTAAAAACAGATTT
    AGTTTTATGGATGCTGCATTTTGCTTAATGTCTGTGGCTTATGTAGGCATTGGTTTTATG
    TTCTTTTATGAAACGAGATCAGAAGGATTACATTACATATTATATGCCTTTTTAATTGTT
    TGGCTTACAGATACAGGGGCTTACTTGTTTGGTAAAATGATGGGTAAACATAAGCTTTGG
    CCAGTAATAAGTCCGAATAAAACAATCGAAGGATTCATAGGTGGCTTGTTCTGTAGTTTG
    ATAGTACCACTTGCAATGTTATATTTTGTAGATTTCAATATGAATGTATGGATATTACTT
    GGAGTGACATTGATTTTAAGTTTATTTGGTCAATTAGGTGATTTAGTGGAATCAGGATTT
    AAGCGTCATTTCGGCGTTAAAGACTCAGGTCGAATACTACCTGGACACGGTGGTATTTTA
    GACCGATTTGACAGCTTTATGTTTGTGTTACCATTATTAAATATTTTATTAATACAATCT
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    783

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS06535 [old locus tag: SACOL1280 ]
  • symbol: SACOL_RS06535
  • description: phosphatidate cytidylyltransferase
  • length: 260
  • theoretical pI: 9.75357
  • theoretical MW: 28964.1
  • GRAVY: 1.03

Function[edit source | edit]

  • reaction:
    EC 2.7.7.41?  ExPASy
    Phosphatidate cytidylyltransferaseCTP + phosphatidate = diphosphate + CDP-diacylglycerol
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    CTPT (CL0234) CTP_transf_1; Cytidylyltransferase family (PF01148; HMM-score: 249)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 8
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.172
    • Ymax_pos: 11
    • Cmax: 0.112
    • Cmax_pos: 50
    • Smax: 0.379
    • Smax_pos: 3
    • Smean: 0.306
    • D: 0.225
  • predicted transmembrane helices (TMHMM): 7

Accession numbers[edit source | edit]

  • GI: 446791157 NCBI
  • RefSeq: WP_000868413 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKVRTLTAIIALIVFLPILLKGGLVLMIFANILALIALKELLNMNMIKFVSVPGLISAVGLIIIMLPQHAGPWVQVIQLKSLIAMSFIVLSYTVLSKNRFSFMDAAFCLMSVAYVGIGFMFFYETRSEGLHYILYAFLIVWLTDTGAYLFGKMMGKHKLWPVISPNKTIEGFIGGLFCSLIVPLAMLYFVDFNMNVWILLGVTLILSLFGQLGDLVESGFKRHFGVKDSGRILPGHGGILDRFDSFMFVLPLLNILLIQS

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS06535 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]