From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS07295 [old locus tag: SACOL1432 ]
  • pan locus tag?: SAUPAN003810000
  • symbol: SACOL_RS07295
  • pan gene symbol?: dapD
  • synonym:
  • product: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS07295 [old locus tag: SACOL1432 ]
  • symbol: SACOL_RS07295
  • product: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 1444494..1445213
  • length: 720
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1444494..1445213) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGGTACAACATTTAACAGCTGAAGAAATTATTCAATATATAAGTGATGCTAAAAAGTCT
    ACACCAATAAAAGTATATTTAAATGGTAATTTTGAAGGCATCACATATCCAGAAAGTTTT
    AAAGTATTTGGTTCAGAACAATCTAAAGTAATCTTTTGTGAAGCGGATGATTGGAAACCT
    TTTTACGAAGCATATGGTAGTCAATTCGAAGATATAGAAATTGAAATGGATCGTCGCAAT
    TCTGCTATTCCATTAAAAGACTTAACAAATACGAATGCACGAATTGAACCAGGTGCGTTT
    ATTAGAGAACAAGCCATTATTGAAGATGGTGCTGTCGTTATGATGGGCGCAACAATTAAT
    ATTGGCGCAGTCGTTGGCGAAGGTACAATGATTGATATGAATGCTACTCTCGGTGGTCGT
    GCTACAACTGGTAAAAATGTACATGTAGGGGCTGGCGCAGTATTAGCAGGTGTGATTGAA
    CCCCCTAGTGCTTCACCGGTTATAATCGAGGATGATGTATTAATCGGTGCAAATGCAGTT
    ATTTTAGAAGGTGTACGTGTTGGTAAAGGTGCTATTGTTGCAGCTGGCGCGATTGTGACA
    CAAGATGTACCAGCTGGTGCAGTTGTTGCTGGTACACCTGCAAAAGTGATTAAGCAAGCT
    TCTGAAGTACAAGATACTAAAAAAGAGATTGTAGCAGCATTAAGAAAACTGAATGACTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS07295 [old locus tag: SACOL1432 ]
  • symbol: SACOL_RS07295
  • description: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase
  • length: 239
  • theoretical pI: 4.43859
  • theoretical MW: 25257.7
  • GRAVY: 0.10795

Function[edit source | edit]

  • reaction:
    EC 2.3.1.89?  ExPASy
    Tetrahydrodipicolinate N-acetyltransferaseAcetyl-CoA + (S)-2,3,4,5-tetrahydropyridine-2,6-dicarboxylate + H2O = CoA + L-2-acetamido-6-oxoheptanedioate
    EC 2.3.1.117?  ExPASy
    2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferaseSuccinyl-CoA + (S)-2,3,4,5-tetrahydropyridine-2,6-dicarboxylate + H2O = CoA + N-succinyl-L-2-amino-6-oxoheptanedioate
  • TIGRFAM:
    2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase (TIGR03532; EC 2.3.1.89; HMM-score: 376.9)
    MetabolismAmino acid biosynthesisAspartate family2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (TIGR00965; EC 2.3.1.117; HMM-score: 95.9)
    sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family (TIGR03570; HMM-score: 91.6)
    phosphonate metabolim protein, transferase hexapeptide repeat family (TIGR03308; HMM-score: 57.4)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesUDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 50.8)
    Cell structureCell envelopeBiosynthesis and degradation of murein sacculus and peptidoglycanUDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 50.8)
    MetabolismCentral intermediary metabolismAmino sugarsUDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 50.8)
    MetabolismEnergy metabolismOtherphenylacetic acid degradation protein PaaY (TIGR02287; HMM-score: 43.2)
    MetabolismAmino acid biosynthesisSerine familyserine O-acetyltransferase (TIGR01172; EC 2.3.1.30; HMM-score: 42.4)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesUDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD (TIGR01853; EC 2.3.1.191; HMM-score: 41.9)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesacyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase (TIGR01852; EC 2.3.1.129; HMM-score: 32.9)
    UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR03992; EC 2.3.1.157,2.7.7.23; HMM-score: 27.1)
    Cell structureCell envelopeBiosynthesis and degradation of murein sacculus and peptidoglycanUDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR03991; EC 2.3.1.157,2.7.7.23; HMM-score: 26.8)
    MetabolismCentral intermediary metabolismAmino sugarsUDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR03991; EC 2.3.1.157,2.7.7.23; HMM-score: 26.8)
    non-ribosomal peptide synthetase terminal domain of unknown function (TIGR02353; HMM-score: 24.3)
    colanic acid biosynthesis acetyltransferase WcaB (TIGR04016; EC 2.3.1.-; HMM-score: 22.8)
    colanic acid biosynthesis acetyltransferase WcaF (TIGR04008; EC 2.3.1.-; HMM-score: 22.1)
  • TheSEED:
  • PFAM:
    no clan definedDapH_N; Tetrahydrodipicolinate succinyltransferase N-terminal (PF08503; HMM-score: 108.3)
    HEXAPEP (CL0536) Hexapep; Bacterial transferase hexapeptide (six repeats) (PF00132; HMM-score: 67.1)
    Hexapep_2; Hexapeptide repeat of succinyl-transferase (PF14602; HMM-score: 50)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.129
    • Ymax_pos: 20
    • Cmax: 0.146
    • Cmax_pos: 20
    • Smax: 0.168
    • Smax_pos: 17
    • Smean: 0.103
    • D: 0.119
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446171984 NCBI
  • RefSeq: WP_000249839 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MVQHLTAEEIIQYISDAKKSTPIKVYLNGNFEGITYPESFKVFGSEQSKVIFCEADDWKPFYEAYGSQFEDIEIEMDRRNSAIPLKDLTNTNARIEPGAFIREQAIIEDGAVVMMGATINIGAVVGEGTMIDMNATLGGRATTGKNVHVGAGAVLAGVIEPPSASPVIIEDDVLIGANAVILEGVRVGKGAIVAAGAIVTQDVPAGAVVAGTPAKVIKQASEVQDTKKEIVAALRKLND

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS07295 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]