From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS07380 [old locus tag: SACOL1447 ]
  • pan locus tag?: SAUPAN003829000
  • symbol: SACOL_RS07380
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS07380 [old locus tag: SACOL1447 ]
  • symbol: SACOL_RS07380
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1458302..1459111
  • length: 810
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1458302..1459111) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGTGTGGACTTAGAAGTATAACATTAGGTACAACAAATATAGAACAGACAAAACATTTC
    ATGGTTGACATATTAGGATTAAATTATGAAGAACTTCTTGAAAACTCAATTCGTTTCGGC
    GATGCAGATATAAGCCCAGGAACAAGACTTCAATTTATACAAGTTCCAAGTGAGCAATTA
    GAAGAATCTCACTTTGTGGGTATTGGATTACGTACACCAACTGACTCAGGTTTAGAGGAG
    TATGCGGAAATATTATCGAATAAGGATATTCCATTTACAACAGTTAAAGAATTAAATGGC
    AATAAATATTTCAGTCTCGAAGATAACAATGGTCATATTTTCTCAATATATTCAAACGAG
    AATAATTATGGCGTTGGTTTAGGTATGCCTTCTTTTGAGAGTGCGGTCAATCCGTTACAT
    CAAGTGCAAGGTTTAGGACCAGTGATTCTTAAAGTGAATCATGTAGATATTACAGGTCAA
    ATTTTAACAAATATATTCGGACTTGAAGTATTTGCAGAATACCAACCCTTCGACAATGCT
    GACTATCATGTCCAAGTATTCAAAGTTGGAACGGGTGGTCTAGGTGGCGAAATACATTTA
    ATGCCTGTAGAAACCGAAATGACAATGCCGGAATATGGCGCAGTCGATCAAGTTGAGTTT
    GAAACGAAAGATGCAGATTTCTTTAATCAAGCGAAATCGCGCTTAGATGAAGTGGAAATA
    CCATATCAAACGCTTGAGCAAGATGATATTGAATCAATTAGAATTACTGAAAACAGTGGA
    TTATCGTTTATATTCACTTTACAAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    810

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS07380 [old locus tag: SACOL1447 ]
  • symbol: SACOL_RS07380
  • description: hypothetical protein
  • length: 269
  • theoretical pI: 4.08
  • theoretical MW: 30084.4
  • GRAVY: -0.235316

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismEnergy metabolismOther2,3-dihydroxybiphenyl 1,2-dioxygenase (TIGR03213; EC 1.13.11.39; HMM-score: 17)
    3,4-dihydroxyphenylacetate 2,3-dioxygenase (TIGR02295; EC 1.13.11.15; HMM-score: 12.4)
  • TheSEED:
  • PFAM:
    Glyoxalase (CL0104) Glyoxalase; Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily (PF00903; HMM-score: 19.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.133
    • Ymax_pos: 18
    • Cmax: 0.131
    • Cmax_pos: 18
    • Smax: 0.192
    • Smax_pos: 17
    • Smean: 0.133
    • D: 0.133
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446256663 NCBI
  • RefSeq: WP_000334518 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MCGLRSITLGTTNIEQTKHFMVDILGLNYEELLENSIRFGDADISPGTRLQFIQVPSEQLEESHFVGIGLRTPTDSGLEEYAEILSNKDIPFTTVKELNGNKYFSLEDNNGHIFSIYSNENNYGVGLGMPSFESAVNPLHQVQGLGPVILKVNHVDITGQILTNIFGLEVFAEYQPFDNADYHVQVFKVGTGGLGGEIHLMPVETEMTMPEYGAVDQVEFETKDADFFNQAKSRLDEVEIPYQTLEQDDIESIRITENSGLSFIFTLQK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS07380 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]