From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS08290 [old locus tag: SACOL1626 ]
  • pan locus tag?: SAUPAN004151000
  • symbol: SACOL_RS08290
  • pan gene symbol?: dgkA
  • synonym:
  • product: diacylglycerol kinase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS08290 [old locus tag: SACOL1626 ]
  • symbol: SACOL_RS08290
  • product: diacylglycerol kinase
  • replicon: chromosome
  • strand: -
  • coordinates: 1657066..1657410
  • length: 345
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1657066..1657410) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGAAAAGGTTTAAATATGCACTTGATGGGCTGAAAATCTTAATTCAAAAAGACTATAAA
    TTTCTTTTACATGTGTTTGCAATGATTGTTGCTATTGTCTTTGGTCTCGTACTAAATATT
    AATCGGATTGAGTGGATATTTATACTCATTGCTATTGCATTAGTTCTCACTGTTGAAGCT
    TTAAACACTGCTATTGAATATGTTGTCGATTTAGTGACCGTTGAATATCATGATTTAGCT
    AAATACGCTAAAGATATTGCGGCTTTTAGTGTACTTATAGTTTCAATATTAGCATTTATT
    ATAGGTTTAATAGTATTTTTACCACATTTTATAGCGTTATTTTAG
    60
    120
    180
    240
    300
    345

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS08290 [old locus tag: SACOL1626 ]
  • symbol: SACOL_RS08290
  • description: diacylglycerol kinase
  • length: 114
  • theoretical pI: 7.76368
  • theoretical MW: 12969.7
  • GRAVY: 1.35

Function[edit source | edit]

  • reaction:
    EC 2.7.1.107?  ExPASy
    Diacylglycerol kinase (ATP)ATP + 1,2-diacyl-sn-glycerol = ADP + 1,2-diacyl-sn-glycerol 3-phosphate
  • TIGRFAM:
    cxxc_20_cxxc protein (TIGR04104; HMM-score: 5.3)
  • TheSEED:
  • PFAM:
    no clan definedDAGK_prokar; Prokaryotic diacylglycerol kinase (PF01219; HMM-score: 112)
    IT (CL0182) CitMHS; Citrate transporter (PF03600; HMM-score: 9.6)
    no clan definedSPC12; Microsomal signal peptidase 12 kDa subunit (SPC12) (PF06645; HMM-score: 8.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.093
    • Ymax_pos: 23
    • Cmax: 0.132
    • Cmax_pos: 46
    • Smax: 0.133
    • Smax_pos: 1
    • Smean: 0.08
    • D: 0.088
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit source | edit]

  • GI: 446742276 NCBI
  • RefSeq: WP_000819532 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKRFKYALDGLKILIQKDYKFLLHVFAMIVAIVFGLVLNINRIEWIFILIAIALVLTVEALNTAIEYVVDLVTVEYHDLAKYAKDIAAFSVLIVSILAFIIGLIVFLPHFIALF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS08290 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]