From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS08455 [old locus tag: SACOL1657 ]
  • pan locus tag?: SAUPAN004191000
  • symbol: SACOL_RS08455
  • pan gene symbol?:
  • synonym:
  • product: enterotoxin

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS08455 [old locus tag: SACOL1657 ]
  • symbol: SACOL_RS08455
  • product: enterotoxin
  • replicon: chromosome
  • strand: -
  • coordinates: 1685330..1686034
  • length: 705
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1685330..1686034) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    TTGTTAGAAGGAATTTTTACAAATTCAGCGAGTGCAATCGAATATTCAGACTTACATCAT
    AAAAGTAAGTTTGATTCAAAGCGTCTAAGTAATGCTAAGATGTCATTCATCAATCCAACT
    CAGCTTGAAAATAAAAACACAAACGATAGACTGTTGAAGCATGATTTGTTATTTCATGAC
    ATGTTCGTAAATGATGATTGGAAAAAGGATTTTAAAGTTGAATTTGAAAATGAGGCACTT
    TCAAAGAAATTTATAAATAAGGATATCGATATATTTGCTGGAAATTATGGATACGGATGT
    CATGGGGGAGCAACCAATAAAACGCAATGTAGTTATGGTGGTGTTACTTTAAGTGACAAT
    AATAAATACGATGATTATAAGAATATACCTTGTAATTTATGGATTGACGGACATCAAACA
    GAAATAGAACTAACTGCAGTAAAAACGAAAAAGAAAATTGTTACTATTCAAGAATTAGAG
    GTTCAATTAAGAAATTATTTGAATGAGAAGTATAAGTTGTACGAACAAGGTGGCGACATT
    GTTAAAGGGTATGTTAAATATTATAATGATGATGAACAAAATGTAGAATATGATTTTTAT
    AATTTAAATGGTGAGTATGGTCGTGAGGTATTAAAAATGTATGCTGATAATAAAACTATC
    AATAGTGACAAATTGCATTTAGATATCTATTTATTCAAATCATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    705

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS08455 [old locus tag: SACOL1657 ]
  • symbol: SACOL_RS08455
  • description: enterotoxin
  • length: 234
  • theoretical pI: 5.91259
  • theoretical MW: 27337.4
  • GRAVY: -0.791026

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    Ant-toxin_C (CL0386) Stap_Strp_tox_C; Staphylococcal/Streptococcal toxin, beta-grasp domain (PF02876; HMM-score: 140.2)
    OB_enterotoxin (CL0658) Stap_Strp_toxin; Staphylococcal/Streptococcal toxin, OB-fold domain (PF01123; HMM-score: 31.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 10
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.121
    • Ymax_pos: 21
    • Cmax: 0.138
    • Cmax_pos: 13
    • Smax: 0.175
    • Smax_pos: 37
    • Smean: 0.104
    • D: 0.115
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_000889280 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MLEGIFTNSASAIEYSDLHHKSKFDSKRLSNAKMSFINPTQLENKNTNDRLLKHDLLFHDMFVNDDWKKDFKVEFENEALSKKFINKDIDIFAGNYGYGCHGGATNKTQCSYGGVTLSDNNKYDDYKNIPCNLWIDGHQTEIELTAVKTKKKIVTIQELEVQLRNYLNEKYKLYEQGGDIVKGYVKYYNDDEQNVEYDFYNLNGEYGREVLKMYADNKTINSDKLHLDIYLFKS

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS08455 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]