From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS09440 [old locus tag: SACOL1840 ]
  • pan locus tag?: SAUPAN004507000
  • symbol: SACOL_RS09440
  • pan gene symbol?:
  • synonym:
  • product: S9 family peptidase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS09440 [old locus tag: SACOL1840 ]
  • symbol: SACOL_RS09440
  • product: S9 family peptidase
  • replicon: chromosome
  • strand: -
  • coordinates: 1895719..1896465
  • length: 747
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1895719..1896465) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGCCAATTGAATATTTTACGCATCAATTCGAAGAAATTACATATTTGTCAGATGACTTA
    CAAGTAAAAGCTTTAATGATGACACCACATCATGAAGTAAATCGCATTGTAGTTTATTTG
    CGAGGTGGCAAAGGTCAAGTAGGACGTGTGCGCGCAGGTAGATTAATGCAATTTTCAGAT
    AGTCAAACTTTAGTGATTGGGCCATACTACCGAGGTAACAATGGGAGTGAAGGCAAAGAC
    GAATTTTACCGTGGCGATTTAAATGATGTGACGCAATTATTAAGGTTGCTACATGATAAA
    TATCCACATGCATTTATCCACATGGTTGGTTTTTCGCGAGGTGGTTTACAAGGATTGTTG
    ACATTTCAAGACTTACCAGTAACAAGTTATACAATCTGGGGTGGTGTCTCAGATATTGAT
    TTAATGTATGAAGAACGTGTCGATTTAAGAGGCATGCTACGAAGAATGATTGGTCATCCG
    AAAAAAGATCGAGCGGCATATGAGGCACGCCAAGCGATTCCAAACATTAATGAAAACAGT
    CCGCCAATATTAATTGTACATGGAGGGAAAGACCAGCAAGTTGGTATTCATCATGCGTAT
    TATTTAGCGGACCAACTAGAGTTAAAAGGTGCCACGCATGAAACATTTTATCAAATGGCA
    GAAGGACATGTGCCAAGACCACCAGCGATGGTTGAAACATTGACTTATATTAAAGAGTTT
    ATGAACCAAGTTGAGTCGCATAGCTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    747

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS09440 [old locus tag: SACOL1840 ]
  • symbol: SACOL_RS09440
  • description: S9 family peptidase
  • length: 248
  • theoretical pI: 6.71011
  • theoretical MW: 28362.1
  • GRAVY: -0.42379

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismEnergy metabolismSugarsUDP-glucose 4-epimerase GalE (TIGR01179; EC 5.1.3.2; HMM-score: 10.6)
  • TheSEED:
  • PFAM:
    AB_hydrolase (CL0028) Peptidase_S9; Prolyl oligopeptidase family (PF00326; HMM-score: 41.7)
    Abhydrolase_1; alpha/beta hydrolase fold (PF00561; HMM-score: 19.9)
    NADP_Rossmann (CL0063) Epimerase; NAD dependent epimerase/dehydratase family (PF01370; HMM-score: 18.2)
    AB_hydrolase (CL0028) Hydrolase_4; Serine aminopeptidase, S33 (PF12146; HMM-score: 15.5)
    Abhydrolase_6; Alpha/beta hydrolase family (PF12697; HMM-score: 13.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.096
    • Ymax_pos: 53
    • Cmax: 0.11
    • Cmax_pos: 36
    • Smax: 0.117
    • Smax_pos: 31
    • Smean: 0.068
    • D: 0.085
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_002868962 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MPIEYFTHQFEEITYLSDDLQVKALMMTPHHEVNRIVVYLRGGKGQVGRVRAGRLMQFSDSQTLVIGPYYRGNNGSEGKDEFYRGDLNDVTQLLRLLHDKYPHAFIHMVGFSRGGLQGLLTFQDLPVTSYTIWGGVSDIDLMYEERVDLRGMLRRMIGHPKKDRAAYEARQAIPNINENSPPILIVHGGKDQQVGIHHAYYLADQLELKGATHETFYQMAEGHVPRPPAMVETLTYIKEFMNQVESHS

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS09440 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]