From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS09840 [old locus tag: SACOL1911 ]
  • pan locus tag?: SAUPAN004789000
  • symbol: SACOL_RS09840
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS09840 [old locus tag: SACOL1911 ]
  • symbol: SACOL_RS09840
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1966319..1966471
  • length: 153
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1966319..1966471) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    ATGTCTAAAGACAAAGATCCAAAATTAAATTATCATGAAGAAGAAAACAGTATGGTAACG
    GATTTTGAAGATTTAAAAGAATTAGGTAAAGAAATGGAACAAATCTCTGATCAAAATGAT
    CAAGAAAAGAATTCTGAAGAAGACAGTCAGTAA
    60
    120
    153

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS09840 [old locus tag: SACOL1911 ]
  • symbol: SACOL_RS09840
  • description: hypothetical protein
  • length: 50
  • theoretical pI: 3.89627
  • theoretical MW: 5936.25
  • GRAVY: -1.87

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    THBO-biosyn (CL0334) PTPS; 6-pyruvoyl tetrahydropterin synthase (PF01242; HMM-score: 13.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0.24
    • Cytoplasmic Membrane Score: 0.05
    • Cellwall Score: 0.8
    • Extracellular Score: 8.91
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.113
    • Ymax_pos: 49
    • Cmax: 0.102
    • Cmax_pos: 14
    • Smax: 0.154
    • Smax_pos: 2
    • Smean: 0.102
    • D: 0.109
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 445953253 NCBI
  • RefSeq: WP_000031108 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS09840 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]