From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS10030 [old locus tag: SACOL1919 ]
  • pan locus tag?: SAUPAN004840000
  • symbol: SACOL_RS10030
  • pan gene symbol?: perR
  • synonym:
  • product: transcriptional repressor

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS10030 [old locus tag: SACOL1919 ]
  • symbol: SACOL_RS10030
  • product: transcriptional repressor
  • replicon: chromosome
  • strand: -
  • coordinates: 1982818..1983264
  • length: 447
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1982818..1983264) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAGTGTTGAAATAGAATCAATTGAACATGAACTAGAAGAATCAATTGCATCATTGCGA
    CAAGCAGGCGTAAGAATTACACCTCAAAGACAAGCAATATTACGTTATTTAATTTCTTCA
    CATACTCATCCAACAGCTGATGAAATTTATCAAGCACTTTCACCTGATTTTCCAAATATA
    AGTGTTGCGACAATATATAATAACTTAAGAGTGTTTAAAGATATTGGAATTGTAAAAGAA
    TTAACATATGGAGACTCATCAAGTCGATTCGACTTTAATACACATAATCATTATCATATT
    ATATGTGAACAATGTGGTAAGATTGTTGATTTTCAATATCCACAGTTAAATGAAATTGAA
    AGATTAGCTCAGCATATGACTGACTTTGACGTAACACATCATCGAATGGAAATTTATGGA
    GTTTGTAAAGAATGCCAAGATAAATAA
    60
    120
    180
    240
    300
    360
    420
    447

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS10030 [old locus tag: SACOL1919 ]
  • symbol: SACOL_RS10030
  • description: transcriptional repressor
  • length: 148
  • theoretical pI: 5.47242
  • theoretical MW: 17183.2
  • GRAVY: -0.421622

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    HTH (CL0123) FUR; Ferric uptake regulator family (PF01475; HMM-score: 138.1)
    HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 17.2)
    no clan definedType2_restr_D3; Type-2 restriction enzyme D3 domain (PF16902; HMM-score: 16.3)
    SR1P; SR1 protein (PF13790; HMM-score: 14.9)
    C2H2-zf (CL0361) zf-BED; BED zinc finger (PF02892; HMM-score: 13.8)
    HTH (CL0123) HTH_11; HTH domain (PF08279; HMM-score: 13.7)
    no clan definedE6; Early Protein (E6) (PF00518; HMM-score: 13.6)
    DASH_Hsk3; DASH complex subunit Hsk3 like (PF08227; HMM-score: 12.4)
    Zn_Beta_Ribbon (CL0167) zf-dskA_traR; Prokaryotic dksA/traR C4-type zinc finger (PF01258; HMM-score: 11)
    no clan definedDUF2039; Uncharacterized conserved protein (DUF2039) (PF10217; HMM-score: 10.8)
    Zn_Beta_Ribbon (CL0167) TF_Zn_Ribbon; TFIIB zinc-binding (PF08271; HMM-score: 10.5)
    Ribosomal_L37e; Ribosomal protein L37e (PF01907; HMM-score: 10.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.123
    • Ymax_pos: 47
    • Cmax: 0.136
    • Cmax_pos: 47
    • Smax: 0.168
    • Smax_pos: 32
    • Smean: 0.084
    • D: 0.108
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446032156 NCBI
  • RefSeq: WP_000110011 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MSVEIESIEHELEESIASLRQAGVRITPQRQAILRYLISSHTHPTADEIYQALSPDFPNISVATIYNNLRVFKDIGIVKELTYGDSSSRFDFNTHNHYHIICEQCGKIVDFQYPQLNEIERLAQHMTDFDVTHHRMEIYGVCKECQDK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS10030 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]