From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS10110 [old locus tag: SACOL1933 ]
  • pan locus tag?: SAUPAN004860000
  • symbol: SACOL_RS10110
  • pan gene symbol?:
  • synonym:
  • product: glutamine amidotransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS10110 [old locus tag: SACOL1933 ]
  • symbol: SACOL_RS10110
  • product: glutamine amidotransferase
  • replicon: chromosome
  • strand: -
  • coordinates: 1997916..1998431
  • length: 516
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1997916..1998431) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGACTAAAAAAGTAGCAATTATTCTAGCAAACGAATTTGAAGATATAGAATATTCAAGC
    CCTAAAGAGGCATTAGAGAATGCAGGCTTTAATACTGTAGTGATTGGAGATACTGCAAAT
    AGTGAAGTTGTTGGTAAACACGGTGAAAAAGTTACTGTCGATGTAGGCATTGCAGAAGCT
    AAACCAGAAGATTATGATGCATTATTAATTCCTGGAGGATTTTCACCAGATCATTTACGT
    GGAGATACAGAAGGTCGATATGGCACATTTGCTAAATACTTTACTAAAAATGATGTACCA
    ACATTTGCCATTTGTCATGGGCCACAAATACTAATAGATACAGACGATTTAAAAGGTCGT
    ACGTTAACAGCAGTATTAAATGTACGCAAAGATTTATCAAATGCAGGCGCACATGTAGTT
    GATGAGTCAGTAGTTGTAGACAACAATATTGTAACAAGTCGAGTACCAGACGATTTAGAT
    GATTTTAATCGAGAAATCGTTAAACAATTACAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    516

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS10110 [old locus tag: SACOL1933 ]
  • symbol: SACOL_RS10110
  • description: glutamine amidotransferase
  • length: 171
  • theoretical pI: 4.36059
  • theoretical MW: 18631.7
  • GRAVY: -0.27193

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidesintracellular protease, PfpI family (TIGR01382; HMM-score: 156.9)
    Unknown functionGeneralDJ-1 family protein (TIGR01383; HMM-score: 62.4)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisphosphoribosylformylglycinamidine synthase I (TIGR01737; EC 6.3.5.3; HMM-score: 25.1)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesisCTP synthase (TIGR00337; EC 6.3.4.2; HMM-score: 20.8)
    MetabolismAmino acid biosynthesisHistidine familyimidazole glycerol phosphate synthase, glutamine amidotransferase subunit (TIGR01855; EC 2.4.2.-; HMM-score: 13.6)
  • TheSEED:
  • PFAM:
    Glutaminase_I (CL0014) DJ-1_PfpI; DJ-1/PfpI family (PF01965; HMM-score: 178.4)
    GATase; Glutamine amidotransferase class-I (PF00117; HMM-score: 25.6)
    GATase_5; CobB/CobQ-like glutamine amidotransferase domain (PF13507; HMM-score: 16.7)
    GATase_3; CobB/CobQ-like glutamine amidotransferase domain (PF07685; HMM-score: 16)
    no clan definedAIDA; Adhesin of bacterial autotransporter system, probable stalk (PF16168; HMM-score: 15.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.137
    • Ymax_pos: 25
    • Cmax: 0.163
    • Cmax_pos: 61
    • Smax: 0.178
    • Smax_pos: 18
    • Smean: 0.108
    • D: 0.126
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446085428 NCBI
  • RefSeq: WP_000163283 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MTKKVAIILANEFEDIEYSSPKEALENAGFNTVVIGDTANSEVVGKHGEKVTVDVGIAEAKPEDYDALLIPGGFSPDHLRGDTEGRYGTFAKYFTKNDVPTFAICHGPQILIDTDDLKGRTLTAVLNVRKDLSNAGAHVVDESVVVDNNIVTSRVPDDLDDFNREIVKQLQ

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS10110 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]