From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS10115 [old locus tag: SACOL1934 ]
  • pan locus tag?: SAUPAN004861000
  • symbol: SACOL_RS10115
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS10115 [old locus tag: SACOL1934 ]
  • symbol: SACOL_RS10115
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1998562..1998723
  • length: 162
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1998562..1998723) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    ATGAATGAACAGCAAACAATCGAACAGATAAAAGCGCGTTTAAATAAGTTTATTGAGGAT
    ATCGATCATGTAAATCCTGATGAAGTACGTGTTGAAGATATAGATGAATGGATTGGATTG
    TTAGATCAGCTTGAAGAAAAGGTTAAATTAGTATCTAAGTAA
    60
    120
    162

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS10115 [old locus tag: SACOL1934 ]
  • symbol: SACOL_RS10115
  • description: hypothetical protein
  • length: 53
  • theoretical pI: 4.16778
  • theoretical MW: 6305.07
  • GRAVY: -0.681132

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionsCRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 12.8)
    MetabolismEnergy metabolismOthertetrahydromethanopterin S-methyltransferase, subunit G (TIGR01149; EC 2.1.1.86; HMM-score: 11.6)
  • TheSEED:
  • PFAM:
    no clan definedDUF3546; Domain of unknown function (DUF3546) (PF12066; HMM-score: 12.9)
    Ribosomal_S16; Ribosomal protein S16 (PF00886; HMM-score: 12.3)
    MtrG; Tetrahydromethanopterin S-methyltransferase, subunit G (PF04210; HMM-score: 11)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.094
    • Ymax_pos: 11
    • Cmax: 0.105
    • Cmax_pos: 32
    • Smax: 0.137
    • Smax_pos: 2
    • Smean: 0.085
    • D: 0.091
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446928151 NCBI
  • RefSeq: WP_001005407 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNEQQTIEQIKARLNKFIEDIDHVNPDEVRVEDIDEWIGLLDQLEEKVKLVSK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS10115 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]