From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS10290 [old locus tag: SACOL1968 ]
  • pan locus tag?: SAUPAN004936000
  • symbol: SACOL_RS10290
  • pan gene symbol?: hisR
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS10290 [old locus tag: SACOL1968 ]
  • symbol: SACOL_RS10290
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2031752..2032054
  • length: 303
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (2031752..2032054) NCBI
  • BioCyc: SACOL_RS10290 BioCyc
  • MicrobesOnline: see SACOL1968

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGCAAATTGAAAAATTACGAGGTGCAGCGTTAGATGAATTGTTTGATGCAATACTAACG
    TTAGAAAATAGAGAAGAATGTTACCAATTTTTCGATGATTTGTGTACTGTAAATGAAATT
    CAATCACTGTCTCAAAGATTACAAGTTGCTAAAATGATTAAGCAAGGTTATACCTATGCA
    ACGATTGAACAAGAATCTGGAGCATCGACTGCAACGATTTCTAGAGTGAAGCGTTCATTA
    CAATGGGGTAATGATGCTTATACAATGATTTTAGATCGTATGAATATTGAAACAAATGAA
    TAA
    60
    120
    180
    240
    300
    303

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS10290 [old locus tag: SACOL1968 ]
  • symbol: SACOL_RS10290
  • description: hypothetical protein
  • length: 100
  • theoretical pI: 4.27043
  • theoretical MW: 11518.9
  • GRAVY: -0.402

Function[edit | edit source]

  • TIGRFAM:
    Unknown function General TrpR homolog YerC/YecD (TIGR02531; HMM-score: 162.2)
    and 2 more
    Metabolism Amino acid biosynthesis Aromatic amino acid family trp operon repressor (TIGR01321; HMM-score: 20.8)
    Signal transduction Regulatory functions DNA interactions trp operon repressor (TIGR01321; HMM-score: 20.8)
  • TheSEED: see SACOL1968
  • PFAM:
    HTH (CL0123) Trp_repressor; Trp repressor protein (PF01371; HMM-score: 117.4)
    and 4 more
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 29.5)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 19.5)
    HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 14.5)
    HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 11.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • genes regulated by HisR*, TF important in Histidine biosynthesis: see SACOL1968

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003872
    • TAT(Tat/SPI): 0.000703
    • LIPO(Sec/SPII): 0.000578
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MQIEKLRGAALDELFDAILTLENREECYQFFDDLCTVNEIQSLSQRLQVAKMIKQGYTYATIEQESGASTATISRVKRSLQWGNDAYTMILDRMNIETNE

Experimental data[edit | edit source]

  • experimentally validated: see SACOL1968
  • protein localization: see SACOL1968
  • quantitative data / protein copy number per cell: see SACOL1968
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]