From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS10385 [old locus tag: SACOL1987 ]
  • pan locus tag?: SAUPAN004972000
  • symbol: SACOL_RS10385
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS10385 [old locus tag: SACOL1987 ]
  • symbol: SACOL_RS10385
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2050677..2050850
  • length: 174
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2050677..2050850) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    ATGTGGAATTTTATTAAATGTGTGTTTAAATTCGTATTTAGCTTAGTTGCTATTACAACA
    TTAGTTGCTGGTGTTGGTGTAGTAGCATTTGCTTATATCTTTAAAAAAGATTTTGAAGAT
    ATTGAAAGAAAAACTAAAGAAATTATTTCTGATATTGAAAGTAAAAATAACTAA
    60
    120
    174

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS10385 [old locus tag: SACOL1987 ]
  • symbol: SACOL_RS10385
  • description: hypothetical protein
  • length: 57
  • theoretical pI: 8.49847
  • theoretical MW: 6564.7
  • GRAVY: 0.445614

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein fateProtein modification and repaircytochrome oxidase maturation protein, cbb3-type (TIGR00847; HMM-score: 20.2)
    MetabolismEnergy metabolismElectron transportcytochrome oxidase maturation protein, cbb3-type (TIGR00847; HMM-score: 20.2)
  • TheSEED:
  • PFAM:
    no clan definedFixS; Cytochrome oxidase maturation protein cbb3-type (PF03597; HMM-score: 16.8)
    DUF3927; Protein of unknown function (DUF3927) (PF13064; HMM-score: 13)
    DUF3918; Protein of unknown function (DUF3918) (PF13056; HMM-score: 11.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.349
    • Ymax_pos: 32
    • Cmax: 0.291
    • Cmax_pos: 32
    • Smax: 0.837
    • Smax_pos: 12
    • Smean: 0.584
    • D: 0.44
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

  • GI: 446189179 NCBI
  • RefSeq: WP_000267034 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MWNFIKCVFKFVFSLVAITTLVAGVGVVAFAYIFKKDFEDIERKTKEIISDIESKNN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS10385 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]