From AureoWiki
Jump to: navigation, search

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS10540 [old locus tag: SACOL2018 ]
  • pan locus tag?: SAUPAN005267000
  • symbol: SACOL_RS10540
  • pan gene symbol?:
  • synonym:
  • product: CPBP family intramembrane metalloprotease

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS10540 [old locus tag: SACOL2018 ]
  • symbol: SACOL_RS10540
  • product: CPBP family intramembrane metalloprotease
  • replicon: chromosome
  • strand: +
  • coordinates: 2078175..2078918
  • length: 744
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2078175..2078918) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGACAAGATTATGGGCATCATTGCTAACTGTTATTATTTATATATTGTCTCAATTTTTA
    CCGCTTCTCATTGTAAAAAAATTACCATTTGTACAATATAGTGGCATAGAACTGACTAAA
    GCAGTCATTTACATACAACTTGTTCTATTTTTAATCGCCGCCACGACGATTATTTTAATT
    AATTTAAAAATTAAAAATCCAACAAAATTAGAATTAGAAGTTAAAGAACCTAAAAAATAT
    ATCATTCCATGGGCATTGCTTGGATTTGCATTGGTAATGATTTATCAAATGGTAGTGAGC
    ATTGTATTAACGCAAATTTATGGTGGACAACAAGTAAGTCCTAATACAGAAAAGCTAATT
    ATTATTGCTCGAAAAATACCTATATTTATCTTCTTTGTATCTATTATTGGTCCTTTATTA
    GAAGAATATGTATTCAGAAAAGTAATCTTTGGAGAATTATTTAATGCGATTAAAGGTAAT
    CGTATCGTGGCATTTATTATTGCTACAACAGTAAGTTCATTAATATTTGCATTAGCACAT
    AATGATTTCAAATTTATTCCAGTTTATTTTGGTATGGGTGTCATTTTTTCATTAGCATAT
    GTTTGGACAAAACGGCTTGCTGTTCCAATTATTATCCATATGTTACAAAACGGATTTGTC
    GTTATATTCCAATTACTTAATCCTGAGGCTTTGAAAAAAGCCACGGAACAAGCGAATTTT
    ATATATCACATTTTTATTCCATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    744

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS10540 [old locus tag: SACOL2018 ]
  • symbol: SACOL_RS10540
  • description: CPBP family intramembrane metalloprotease
  • length: 247
  • theoretical pI: 10.2821
  • theoretical MW: 28163.1
  • GRAVY: 0.940081

Function[edit source | edit]

  • TIGRFAM:
    exosortase E/protease, VPEID-CTERM system (TIGR04162; EC 3.4.22.-; HMM-score: 28.4)
    and 1 more
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesCAAX prenyl protease-related protein (TIGR03008; HMM-score: 22.4)
  • TheSEED:
  • PFAM:
    Peptidase_U (CL0472) Abi; CAAX protease self-immunity (PF02517; HMM-score: 58.5)
    and 1 more
    no clan defined2TM; 2TM domain (PF13239; HMM-score: 6.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 6
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.116
    • Ymax_pos: 11
    • Cmax: 0.125
    • Cmax_pos: 28
    • Smax: 0.174
    • Smax_pos: 2
    • Smean: 0.134
    • D: 0.123
  • predicted transmembrane helices (TMHMM): 6

Accession numbers[edit source | edit]

  • GI: 446119780 NCBI
  • RefSeq: WP_000197635 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MTRLWASLLTVIIYILSQFLPLLIVKKLPFVQYSGIELTKAVIYIQLVLFLIAATTIILINLKIKNPTKLELEVKEPKKYIIPWALLGFALVMIYQMVVSIVLTQIYGGQQVSPNTEKLIIIARKIPIFIFFVSIIGPLLEEYVFRKVIFGELFNAIKGNRIVAFIIATTVSSLIFALAHNDFKFIPVYFGMGVIFSLAYVWTKRLAVPIIIHMLQNGFVVIFQLLNPEALKKATEQANFIYHIFIP

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS10540 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]