From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS10555 [old locus tag: SACOL2021 ]
  • pan locus tag?: SAUPAN005271000
  • symbol: SACOL_RS10555
  • pan gene symbol?:
  • synonym:
  • product: hydrolase in agr operon

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS10555 [old locus tag: SACOL2021 ]
  • symbol: SACOL_RS10555
  • product: hydrolase in agr operon
  • replicon: chromosome
  • strand: +
  • coordinates: 2081386..2082171
  • length: 786
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2081386..2082171) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGAAAGTCCAAATTTATCAATTACCGATTGTTTTTGGAGATAGTTCTAAAAATGAAACT
    CAAATAACGCAATGGTTCGAAAAAAATATGAATGCTGAAGTAGATGTAGTCGTTTTACCT
    GAAATGTGGAATAATGGCTATGATTTAGAGCATTTAAATGAAAAAGCAGATAATAATCTA
    GGACAAAGTTTTTCATTTATTAAACATTTAGCTGAAAAATATAAAGTCGATATCGTAGCT
    GGGTCAGTTTCTAACATTAGAAACAATCAAATATTTAATACAGCTTTTAGTGTGAATAAA
    AGTGGCCAGCTGATTAATGAATACGACAAAGTTCATTTAGTTCCTATGTTAAGAGAGCAT
    GAATTTTTAACCGCTGGCGAATACGTAGCTGAACCCTTTCAATTGTCTGACGGTACTTAT
    GTGACCCAACTTATCTGTTATGATTTACGTTTTCCAGAATTATTAAGATATCCTGCTCGT
    AGTGGTGCTAAAATTGCATTTTATGTGGCGCAATGGCCTATGTCACGTCTTCAACATTGG
    CATTCATTACTAAAGGCACGTGCAATTGAAAATAATATGTTTGTCATTGGAACTAATAGC
    ACTGGATTCGATGGTAACACAGAATATGCTGGTCATTCGATAGTTATAAACCCAAATGGA
    GATTTAGTTGGAGAATTAAATGAATCCGCAGATATTTTGACTGTAGATTTAAACTTAAAT
    GAAGTAGAACAGCAACGCGAAAATATACCTGTATTTAAAAGTATTAAATTAGATTTGTAT
    AAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    786

Protein[edit source | edit]

Protein Data Bank: 3P8K

General[edit source | edit]

  • locus tag: SACOL_RS10555 [old locus tag: SACOL2021 ]
  • symbol: SACOL_RS10555
  • description: hydrolase in agr operon
  • length: 261
  • theoretical pI: 4.87589
  • theoretical MW: 29825.5
  • GRAVY: -0.301533

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismCentral intermediary metabolismPolyamine biosynthesisN-carbamoylputrescine amidase (TIGR03381; EC 3.5.1.53; HMM-score: 68.8)
    Genetic information processingProtein fateProtein modification and repairapolipoprotein N-acyltransferase (TIGR00546; EC 2.3.1.-; HMM-score: 57.4)
  • TheSEED:
  • PFAM:
    no clan definedCN_hydrolase; Carbon-nitrogen hydrolase (PF00795; HMM-score: 152.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.129
    • Ymax_pos: 26
    • Cmax: 0.119
    • Cmax_pos: 26
    • Smax: 0.185
    • Smax_pos: 47
    • Smean: 0.133
    • D: 0.131
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446790704 NCBI
  • RefSeq: WP_000867960 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKVQIYQLPIVFGDSSKNETQITQWFEKNMNAEVDVVVLPEMWNNGYDLEHLNEKADNNLGQSFSFIKHLAEKYKVDIVAGSVSNIRNNQIFNTAFSVNKSGQLINEYDKVHLVPMLREHEFLTAGEYVAEPFQLSDGTYVTQLICYDLRFPELLRYPARSGAKIAFYVAQWPMSRLQHWHSLLKARAIENNMFVIGTNSTGFDGNTEYAGHSIVINPNGDLVGELNESADILTVDLNLNEVEQQRENIPVFKSIKLDLYK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS10555 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]