From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS10670 [old locus tag: SACOL2043 ]
  • pan locus tag?: SAUPAN005304000
  • symbol: SACOL_RS10670
  • pan gene symbol?: ilvB
  • synonym:
  • product: acetolactate synthase, large subunit, biosynthetic type

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS10670 [old locus tag: SACOL2043 ]
  • symbol: SACOL_RS10670
  • product: acetolactate synthase, large subunit, biosynthetic type
  • replicon: chromosome
  • strand: +
  • coordinates: 2102785..2104554
  • length: 1770
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2102785..2104554) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    1321
    1381
    1441
    1501
    1561
    1621
    1681
    1741
    ATGTCTAAAACTCAACATGAAGTAAACCAAAATATTGACCCTTTAAAAATGGCTGAATCA
    CTTGAACCTGAACAACTAAATGAAAAAACTTTAAATGATATGCGTTCAGGATCAGAAGTG
    CTAGTAGAAGCTCTACTTAAAGAAAATGTGGATTATTTATTCGGTTATCCTGGTGGTGCC
    GTACTACCTTTATATGACACGTTTTATGATGGTAAAATCAAACATATTTTAGCAAGACAC
    GAACAAGGTGCTGTTCATGCTGCAGAAGGTTATGCACGTGTATCTGGTAAAACTGGCGTC
    GTTGTAGTTACAAGCGGTCCAGGTGCAACTAATGTAATGACAGGTATTACGGATGCACAT
    TGCGACTCTTTACCTCTAGTTGTATTCACTGGACAAGTTGCTACACCAGGCATTGGTAAA
    GATGCATTCCAAGAAGCGGATATTCTATCTATGACTTCACCAATTACAAAACAAAATTAT
    CAAGTGAAACGTGTTGAAGATATCCCTAAAATCGTACACGAAGCTTTCCATGTAGCTAAT
    TCTGGACGCAAAGGTCCTGTAGTGATTGATTTTCCAAAAGATATGGGTGTTTTAGCTACA
    AATGTGGATTTATGCGACGAAATCAATATTCCAGGTTATGAAGTTGTTACAGAACCAGAA
    AATAAAGACATTGACACTTTCATCTCACTTTTAAAAGAAGCGAAAAAGCCTGTCGTATTA
    GCCGGCGCAGGTATTAATCAATCAAAATCAAATCAATTATTAACACAGTTTGTTAATAAA
    CATCAAATCCCAACAGTTACTACTTTACTAGGTCTAGGTGCTGTACCTTATGAGGATACA
    CTATTTTTAGGTATGGGAGGAATGCATGGTTCTTATGCTAGTAACATGGCATTAACTGAG
    TGTGATTTACTCATTAATTTAGGTAGCCGCTTCGATGATAGATTAGCAAGCAAACCTGAT
    GCCTTTGCACCTAACGCCAAAATTGTACATGTAGATATTGATCCTTCAGAAATCAATAAA
    GTTATTCATGTAGATTTAGGTATTATTGCAGACTGTAAAAGATTTTTAGAATGTTTAAAT
    GATAAAAATGTTGAGACTATAGAACACAGTGACTGGGTTAAACATTGTCAAAATAATAAG
    CAGAAACACCCATTTAAACTTGGTGAAGAAGATCAAGTATTTTGTAAGCCACAACAAACA
    ATCGAATATATCGGCAAAATTACAAATGGTGAAGCAATTGTTACTACAGACGTGGGACAA
    CATCAAATGTGGGCAGCTCAATTTTATCCATTTAAAAATCACGGACAATGGGTTACAAGC
    GGTGGTTTAGGAACAATGGGATTCGGTATTCCTTCGTCAATTGGTGCCAAATTAGCTAAT
    CCTGATAAAACAGTCGTATGTTTCGTCGGTGACGGTGGTTTCCAAATGACAAACCAAGAA
    ATGGCACTTTTACCCGAATATGGTTTAGATGTCAAAATCGTACTAATCAATAATGGAACA
    TTAGGTATGGTTAAACAATGGCAAGATAAGTTCTTTAATCAACGCTTCTCACACTCAGTA
    TTTAATGGTCAACCTGATTTTATGAAAATGGCAGAAGCATATGGCGTCAAAGGTTTCTTA
    ATCGATAAGCCAGAACAACTGGAAGAACAATTAGATGCAGCGTTTGCTTATCAAGGACCA
    GCTTTAATTGAGGTTCGTATTTCCCCTACTGAAGCTGTAACCCCAATGGTTCCGAGTGGC
    AAATCAAATCATGAAATGGAGGGCTTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1320
    1380
    1440
    1500
    1560
    1620
    1680
    1740
    1770

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS10670 [old locus tag: SACOL2043 ]
  • symbol: SACOL_RS10670
  • description: acetolactate synthase, large subunit, biosynthetic type
  • length: 589
  • theoretical pI: 5.02481
  • theoretical MW: 64491.1
  • GRAVY: -0.201528

Function[edit source | edit]

  • reaction:
    EC 2.2.1.6?  ExPASy
    Acetolactate synthase2 pyruvate = 2-acetolactate + CO2
  • TIGRFAM:
    MetabolismAmino acid biosynthesisPyruvate familyacetolactate synthase, large subunit, biosynthetic type (TIGR00118; EC 2.2.1.6; HMM-score: 744.1)
    glyoxylate carboligase (TIGR01504; EC 4.1.1.47; HMM-score: 322.9)
    MetabolismEnergy metabolismFermentationacetolactate synthase, catabolic (TIGR02418; EC 2.2.1.6; HMM-score: 305)
    MetabolismCentral intermediary metabolismOthersulfoacetaldehyde acetyltransferase (TIGR03457; EC 2.3.3.15; HMM-score: 283.9)
    MetabolismEnergy metabolismAerobicpyruvate oxidase (TIGR02720; EC 1.2.3.3; HMM-score: 279.2)
    MetabolismEnergy metabolismSugars3,5/4-trihydroxycyclohexa-1,2-dione hydrolase (TIGR04377; EC 3.7.1.-; HMM-score: 219.3)
    Cellular processesCellular processesDetoxificationoxalyl-CoA decarboxylase (TIGR03254; EC 4.1.1.8; HMM-score: 188.8)
    indolepyruvate/phenylpyruvate decarboxylase (TIGR03394; EC 4.1.1.43,4.1.1.74; HMM-score: 122.4)
    MetabolismCentral intermediary metabolismOtherindolepyruvate decarboxylase (TIGR03393; EC 4.1.1.74; HMM-score: 81.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinone2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (TIGR00173; EC 2.2.1.9; HMM-score: 58.3)
    phosphonopyruvate decarboxylase (TIGR03297; EC 4.1.1.82; HMM-score: 39.7)
    sulfopyruvate decarboxylase, beta subunit (TIGR03846; EC 4.1.1.79; HMM-score: 30.9)
    2-oxoacid:acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family (TIGR02177; HMM-score: 16)
    MetabolismEnergy metabolismChemoautotrophyCO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit (TIGR00315; EC 1.2.99.2; HMM-score: 12.1)
  • TheSEED:
  • PFAM:
    THDP-binding (CL0254) TPP_enzyme_N; Thiamine pyrophosphate enzyme, N-terminal TPP binding domain (PF02776; HMM-score: 195.2)
    TPP_enzyme_C; Thiamine pyrophosphate enzyme, C-terminal TPP binding domain (PF02775; HMM-score: 176.7)
    FAD_DHS (CL0085) TPP_enzyme_M; Thiamine pyrophosphate enzyme, central domain (PF00205; HMM-score: 145.1)
    THDP-binding (CL0254) POR_N; Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg (PF01855; HMM-score: 14.8)
    XFP_N; XFP N-terminal domain (PF09364; HMM-score: 12.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Mg2+, thiamine diphosphate
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.112
    • Ymax_pos: 29
    • Cmax: 0.105
    • Cmax_pos: 21
    • Smax: 0.16
    • Smax_pos: 17
    • Smean: 0.104
    • D: 0.109
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 445969965 NCBI
  • RefSeq: WP_000047820 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MSKTQHEVNQNIDPLKMAESLEPEQLNEKTLNDMRSGSEVLVEALLKENVDYLFGYPGGAVLPLYDTFYDGKIKHILARHEQGAVHAAEGYARVSGKTGVVVVTSGPGATNVMTGITDAHCDSLPLVVFTGQVATPGIGKDAFQEADILSMTSPITKQNYQVKRVEDIPKIVHEAFHVANSGRKGPVVIDFPKDMGVLATNVDLCDEINIPGYEVVTEPENKDIDTFISLLKEAKKPVVLAGAGINQSKSNQLLTQFVNKHQIPTVTTLLGLGAVPYEDTLFLGMGGMHGSYASNMALTECDLLINLGSRFDDRLASKPDAFAPNAKIVHVDIDPSEINKVIHVDLGIIADCKRFLECLNDKNVETIEHSDWVKHCQNNKQKHPFKLGEEDQVFCKPQQTIEYIGKITNGEAIVTTDVGQHQMWAAQFYPFKNHGQWVTSGGLGTMGFGIPSSIGAKLANPDKTVVCFVGDGGFQMTNQEMALLPEYGLDVKIVLINNGTLGMVKQWQDKFFNQRFSHSVFNGQPDFMKMAEAYGVKGFLIDKPEQLEEQLDAAFAYQGPALIEVRISPTEAVTPMVPSGKSNHEMEGL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS10670 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]