From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS11665 [old locus tag: SACOL2216 ]
  • pan locus tag?: SAUPAN005679000
  • symbol: SACOL_RS11665
  • pan gene symbol?: rpmJ
  • synonym:
  • product: 50S ribosomal protein L36

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS11665 [old locus tag: SACOL2216 ]
  • symbol: SACOL_RS11665
  • product: 50S ribosomal protein L36
  • replicon: chromosome
  • strand: -
  • coordinates: 2295776..2295889
  • length: 114
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2295776..2295889) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    ATGAAAGTAAGACCATCAGTAAAACCTATTTGCGAAAAATGTAAAGTCATTAAACGTAAA
    GGTAAAGTAATGGTAATTTGTGAAAATCCAAAACACAAACAAAGACAAGGTTAA
    60
    114

Protein[edit source | edit]

Protein Data Bank: 5LI0
Protein Data Bank: 4WCE
Protein Data Bank: 4WFB
Protein Data Bank: 4WFA
Protein Data Bank: 5HL7

General[edit source | edit]

  • locus tag: SACOL_RS11665 [old locus tag: SACOL2216 ]
  • symbol: SACOL_RS11665
  • description: 50S ribosomal protein L36
  • length: 37
  • theoretical pI: 11.0798
  • theoretical MW: 4305.35
  • GRAVY: -0.808108

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein bL36 (TIGR01022; HMM-score: 82.8)
  • TheSEED:
  • PFAM:
    no clan definedRibosomal_L36; Ribosomal protein L36 (PF00444; HMM-score: 70.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.221
    • Ymax_pos: 14
    • Cmax: 0.101
    • Cmax_pos: 36
    • Smax: 0.608
    • Smax_pos: 8
    • Smean: 0.488
    • D: 0.325
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446791086 NCBI
  • RefSeq: WP_000868342 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKVRPSVKPICEKCKVIKRKGKVMVICENPKHKQRQG

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS11665 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]