From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS12425 [old locus tag: SACOL2366 ]
  • pan locus tag?: SAUPAN005885000
  • symbol: SACOL_RS12425
  • pan gene symbol?: paiA
  • synonym:
  • product: N-acetyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS12425 [old locus tag: SACOL2366 ]
  • symbol: SACOL_RS12425
  • product: N-acetyltransferase
  • replicon: chromosome
  • strand: -
  • coordinates: 2427030..2427545
  • length: 516
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2427030..2427545) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGGCTGGGATAATCAAAGAAATTTCAGAACAAAATGCTAGTGAATTAGTTGAATTAGCA
    ACTAGAACATTTTATGACACGTTTGGTTCTTACTATGATGACAAAGATTTTGATCAATTT
    TTTAAAGACAATTATACTGTAGAGAAATTTACACAAGAGATTAACCATGTAGATTCATTT
    CATTATTTTTATCAAGAAGATGGTGCGAATGTTGGTTATATAAAGATGAATATTAATAGT
    GCTCAAACTGAAGAAATGGGGGAGACCTATTTAGAAGTGCAGCGCATATATTTTTTGAAA
    GACTTTCAAGGTGGCGGAAGAGGTTCACAATTGATAGAATTGGCCGAAAAAATTGCTCAA
    GAACATAATAAACATAAAATTTGGCTAGGAGTTTGGGAGCATAATCCTCGTGCTCAAGCA
    TTTTATAAACGTCATGGATTTAAAGTGGTTGGTGAACATCATTTTCAAACAGGTGATGTA
    ACGGATACAGATTTAATTATGGAAAAAGAGTTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    516

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS12425 [old locus tag: SACOL2366 ]
  • symbol: SACOL_RS12425
  • description: N-acetyltransferase
  • length: 171
  • theoretical pI: 4.71992
  • theoretical MW: 20071.1
  • GRAVY: -0.690643

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal-protein-alanine acetyltransferase (TIGR01575; EC 2.3.1.128; HMM-score: 49.4)
    UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine N-acetyltransferase (TIGR03585; EC 2.3.1.202; HMM-score: 27.9)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersGlutathione and analogsmycothiol synthase (TIGR03448; EC 2.3.1.189; HMM-score: 18.1)
  • TheSEED:
  • PFAM:
    Acetyltrans (CL0257) Acetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 57.2)
    Acetyltransf_10; Acetyltransferase (GNAT) domain (PF13673; HMM-score: 53.8)
    Acetyltransf_7; Acetyltransferase (GNAT) domain (PF13508; HMM-score: 44.7)
    Acetyltransf_4; Acetyltransferase (GNAT) domain (PF13420; HMM-score: 35.7)
    FR47; FR47-like protein (PF08445; HMM-score: 24.2)
    Acetyltransf_3; Acetyltransferase (GNAT) domain (PF13302; HMM-score: 20.5)
    GH_CE (CL0158) Glyco_hydro_57; Glycosyl hydrolase family 57 (PF03065; HMM-score: 15)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.094
    • Ymax_pos: 70
    • Cmax: 0.108
    • Cmax_pos: 26
    • Smax: 0.106
    • Smax_pos: 69
    • Smean: 0.076
    • D: 0.087
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446830055 NCBI
  • RefSeq: WP_000907311 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MAGIIKEISEQNASELVELATRTFYDTFGSYYDDKDFDQFFKDNYTVEKFTQEINHVDSFHYFYQEDGANVGYIKMNINSAQTEEMGETYLEVQRIYFLKDFQGGGRGSQLIELAEKIAQEHNKHKIWLGVWEHNPRAQAFYKRHGFKVVGEHHFQTGDVTDTDLIMEKEL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS12425 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]