From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS12925 [old locus tag: SACOL2464 ]
  • pan locus tag?: SAUPAN006013000
  • symbol: SACOL_RS12925
  • pan gene symbol?:
  • synonym:
  • product: Txe/YoeB family addiction module toxin

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS12925 [old locus tag: SACOL2464 ]
  • symbol: SACOL_RS12925
  • product: Txe/YoeB family addiction module toxin
  • replicon: chromosome
  • strand: -
  • coordinates: 2523369..2523635
  • length: 267
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2523369..2523635) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    ATGAGCAATTACACGGTTAAGATTAAAAATTCAGCGAAATCAGATTTAAAGAAAATAAAA
    CATTCTTATTTAAAGAAGTCATTTTTAGAAATTGTTGAGACTTTAAAAAATGATCCGTAT
    AAAATAACACAATCTTTTGAAAAATTAGAGCCTAAATATTTAGAGCGATATTCAAGAAGA
    ATTAACCATCAGCACAGGGTCGTCTATACCGTAGATGATCGAAATAAAGAAGTATTAATA
    CTATCGGCATGGTCACATTATGATTAA
    60
    120
    180
    240
    267

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS12925 [old locus tag: SACOL2464 ]
  • symbol: SACOL_RS12925
  • description: Txe/YoeB family addiction module toxin
  • length: 88
  • theoretical pI: 10.1415
  • theoretical MW: 10648.1
  • GRAVY: -0.892045

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesToxin production and resistanceaddiction module toxin, Txe/YoeB family (TIGR02116; HMM-score: 99.4)
    Genetic information processingMobile and extrachromosomal element functionsOtheraddiction module toxin, Txe/YoeB family (TIGR02116; HMM-score: 99.4)
    Cellular processesCellular processesToxin production and resistanceaddiction module toxin, RelE/StbE family (TIGR02385; HMM-score: 21.2)
    Genetic information processingMobile and extrachromosomal element functionsOtheraddiction module toxin, RelE/StbE family (TIGR02385; HMM-score: 21.2)
  • TheSEED:
  • PFAM:
    Plasmid-antitox (CL0136) YoeB_toxin; YoeB-like toxin of bacterial type II toxin-antitoxin system (PF06769; HMM-score: 38.1)
    ParE_toxin; ParE toxin of type II toxin-antitoxin system, parDE (PF05016; HMM-score: 28.7)
    HigB-like_toxin; RelE-like toxin of type II toxin-antitoxin system HigB (PF05015; HMM-score: 19.7)
    ParE-like_toxin; ParE-like toxin of type II bacterial toxin-antitoxin system (PF15781; HMM-score: 18.4)
    no clan definedTINF2_N; TERF1-interacting nuclear factor 2 N-terminus (PF14973; HMM-score: 16.7)
    Met_repress (CL0057) VAPB_antitox; Putative antitoxin (PF02697; HMM-score: 16.3)
    HHH (CL0198) HHH_4; Helix-hairpin-helix containing domain (PF14490; HMM-score: 13.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.173
    • Ymax_pos: 15
    • Cmax: 0.105
    • Cmax_pos: 15
    • Smax: 0.311
    • Smax_pos: 9
    • Smean: 0.281
    • D: 0.215
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 445996193 NCBI
  • RefSeq: WP_000074048 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MSNYTVKIKNSAKSDLKKIKHSYLKKSFLEIVETLKNDPYKITQSFEKLEPKYLERYSRRINHQHRVVYTVDDRNKEVLILSAWSHYD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS12925 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]