From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS13100 [old locus tag: SACOL2500 ]
  • pan locus tag?: SAUPAN006089000
  • symbol: SACOL_RS13100
  • pan gene symbol?:
  • synonym:
  • product: (deoxy)nucleoside triphosphate pyrophosphohydrolase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS13100 [old locus tag: SACOL2500 ]
  • symbol: SACOL_RS13100
  • product: (deoxy)nucleoside triphosphate pyrophosphohydrolase
  • replicon: chromosome
  • strand: -
  • coordinates: 2554002..2554394
  • length: 393
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2554002..2554394) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAAAAAGTAATCAATGTAGTAGGAGCTATTATTTTTTCTGATAACAAAATTCTTTGT
    GCACAGAGAAGTGAAAAAATGAGTCTGCCTTTAATGTGGGAATTTCCTGGCGGTAAGGTT
    GAAAAGAATGAAACTGAAAAAGACGCTTTGATTAGAGAAATTAGAGAAGAAATGAAATGT
    GATTTAATTGTTGGAGACAAAGTTATAACTACAGAACATGAATATGATTTTGGAATTGTT
    AGGTTAACAACATACAAATGTACTTTAAACAAAGAGTTACCAACTCTAACTGAACATAAG
    AGTATTGAATGGTTGTCAATAAACGAACTTGATAAATTAAATTGGGCCCCAGCGGATATA
    CCAGCCGTTAATAAAATTATGACTGAGGGATAA
    60
    120
    180
    240
    300
    360
    393

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS13100 [old locus tag: SACOL2500 ]
  • symbol: SACOL_RS13100
  • description: (deoxy)nucleoside triphosphate pyrophosphohydrolase
  • length: 130
  • theoretical pI: 5.03646
  • theoretical MW: 14894.3
  • GRAVY: -0.277692

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairmutator mutT protein (TIGR00586; EC 3.6.1.-; HMM-score: 74.6)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairnucleoside triphosphatase YtkD (TIGR02705; EC 3.6.1.-; HMM-score: 30.3)
  • TheSEED:
  • PFAM:
    NUDIX (CL0261) NUDIX; NUDIX domain (PF00293; HMM-score: 55.2)
    NUDIX_4; NUDIX domain (PF14815; HMM-score: 42.9)
    E-set (CL0159) PKD_3; PKD-like domain (PF16820; HMM-score: 12.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.193
    • Ymax_pos: 22
    • Cmax: 0.176
    • Cmax_pos: 22
    • Smax: 0.286
    • Smax_pos: 18
    • Smean: 0.187
    • D: 0.191
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446678608 NCBI
  • RefSeq: WP_000755954 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKKVINVVGAIIFSDNKILCAQRSEKMSLPLMWEFPGGKVEKNETEKDALIREIREEMKCDLIVGDKVITTEHEYDFGIVRLTTYKCTLNKELPTLTEHKSIEWLSINELDKLNWAPADIPAVNKIMTEG

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS13100 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]