From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS13350 [old locus tag: SACOL2550 ]
  • pan locus tag?: SAUPAN006190000
  • symbol: SACOL_RS13350
  • pan gene symbol?:
  • synonym:
  • product: thiol reductase thioredoxin

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS13350 [old locus tag: SACOL2550 ]
  • symbol: SACOL_RS13350
  • product: thiol reductase thioredoxin
  • replicon: chromosome
  • strand: -
  • coordinates: 2607795..2608139
  • length: 345
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2607795..2608139) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGGTTAAGCAATTAAATAGTGTCGAAGCATTCCGTGAATTTATTCATCAATATCCGTTA
    GCAGTTGTACATGTCATGCGCGATCAGTGTAGCGTGTGTCATGCCGTTTTACCACAAATT
    GAAGACTTGATGCAATCATATCCCAATGTGCCATTAGCTGTGATTAATCAAAGTCAGGTG
    GAAGCTATTGCTGGAGAATTAAATATTTTCACTGTACCTGTGGATTTAATTTTTATGAAT
    GGAAAAGAAATGCATCGTCAAGGGCGTTTTATCGATATGCAACGTTTTGAACATCATCTT
    AAGCAAATGAATGATAGTGTAAATAACGATGTCGATGAGCATTAA
    60
    120
    180
    240
    300
    345

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS13350 [old locus tag: SACOL2550 ]
  • symbol: SACOL_RS13350
  • description: thiol reductase thioredoxin
  • length: 114
  • theoretical pI: 5.4387
  • theoretical MW: 13215.1
  • GRAVY: -0.192982

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismEnergy metabolismElectron transportthioredoxin (TIGR01068; HMM-score: 32.8)
    type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB (TIGR02738; HMM-score: 12.6)
  • TheSEED:
  • PFAM:
    Thioredoxin (CL0172) Thioredoxin; Thioredoxin (PF00085; HMM-score: 33)
    Thioredoxin_3; Thioredoxin domain (PF13192; HMM-score: 17.7)
    CDA (CL0109) Toxin-deaminase; The BURPS668_1122 family of deaminases (PF14424; HMM-score: 12.8)
    Cytochrome-c (CL0318) Cytochrom_C1; Cytochrome C1 family (PF02167; HMM-score: 12.6)
    LDH_C (CL0341) Ldh_1_C; lactate/malate dehydrogenase, alpha/beta C-terminal domain (PF02866; HMM-score: 12.1)
    Thioredoxin (CL0172) Phosducin; Phosducin (PF02114; HMM-score: 11.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.131
    • Ymax_pos: 36
    • Cmax: 0.125
    • Cmax_pos: 36
    • Smax: 0.172
    • Smax_pos: 34
    • Smean: 0.122
    • D: 0.128
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446162807 NCBI
  • RefSeq: WP_000240662 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MVKQLNSVEAFREFIHQYPLAVVHVMRDQCSVCHAVLPQIEDLMQSYPNVPLAVINQSQVEAIAGELNIFTVPVDLIFMNGKEMHRQGRFIDMQRFEHHLKQMNDSVNNDVDEH

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS13350 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]