From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS13865 [old locus tag: SACOL2647 ]
  • pan locus tag?: SAUPAN006340000
  • symbol: SACOL_RS13865
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS13865 [old locus tag: SACOL2647 ]
  • symbol: SACOL_RS13865
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2707354..2707554
  • length: 201
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2707354..2707554) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGATACTAGTAATGTTATCTCCATTATTAATCATATTCTTTATAGTGTTGTCTATTTTA
    GAAGAGCGTAAACGTACGAAGAAAAAGCAACTCGAGAAAGAAAAAGCAAATACACTAAAT
    CAAAATACAAATGACACGGAAAGTTCAAATCAAGAGCCGTCATTGCAGCAGGATAAAGAA
    CAAAAAGATAACAAAGGATAA
    60
    120
    180
    201

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS13865 [old locus tag: SACOL2647 ]
  • symbol: SACOL_RS13865
  • description: hypothetical protein
  • length: 66
  • theoretical pI: 9.17593
  • theoretical MW: 7687.8
  • GRAVY: -0.836364

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesAdaptations to atypical conditionsphage shock protein B (TIGR02976; HMM-score: 14)
    Cellular processesCellular processesSporulation and germinationstage III sporulation protein AF (TIGR02896; HMM-score: 12.3)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsD-galactonate transporter (TIGR00893; HMM-score: 10.1)
  • TheSEED:
  • PFAM:
    no clan definedDUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 21.2)
    DUF1510; Protein of unknown function (DUF1510) (PF07423; HMM-score: 19.7)
    Di19_C; Stress-induced protein Di19, C-terminal (PF14571; HMM-score: 19.1)
    TMEM156; TMEM156 protein family (PF15106; HMM-score: 16)
    Transporter (CL0375) Connexin; Connexin (PF00029; HMM-score: 14.8)
    no clan definedCadherin_C_2; Cadherin cytoplasmic C-terminal (PF16492; HMM-score: 14.7)
    OSTbeta; Organic solute transporter subunit beta protein (PF15048; HMM-score: 14.1)
    EphA2_TM; Ephrin type-A receptor 2 transmembrane domain (PF14575; HMM-score: 13.8)
    YajC; Preprotein translocase subunit (PF02699; HMM-score: 13.4)
    GRP; Glycine rich protein family (PF07172; HMM-score: 13.4)
    Ctr; Ctr copper transporter family (PF04145; HMM-score: 13.1)
    DUF4725; Domain of unknown function (DUF4725) (PF15854; HMM-score: 12.9)
    OAD_gamma; Oxaloacetate decarboxylase, gamma chain (PF04277; HMM-score: 12.9)
    Ninjurin; Ninjurin (PF04923; HMM-score: 12.5)
    MotB_plug; Membrane MotB of proton-channel complex MotA/MotB (PF13677; HMM-score: 12.1)
    CLN3; CLN3 protein (PF02487; HMM-score: 11.9)
    GPCR_A (CL0192) SID-1_RNA_chan; dsRNA-gated channel SID-1 (PF13965; HMM-score: 11.7)
    7tm_1; 7 transmembrane receptor (rhodopsin family) (PF00001; HMM-score: 11.1)
    no clan definedTMEM154; TMEM154 protein family (PF15102; HMM-score: 11)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.221
    • Ymax_pos: 12
    • Cmax: 0.129
    • Cmax_pos: 57
    • Smax: 0.659
    • Smax_pos: 1
    • Smean: 0.454
    • D: 0.312
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

  • GI: 446527382 NCBI
  • RefSeq: WP_000604728 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MILVMLSPLLIIFFIVLSILEERKRTKKKQLEKEKANTLNQNTNDTESSNQEPSLQQDKEQKDNKG

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS13865 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]