From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00001
  • pan locus tag?: SAUPAN000006000
  • symbol: dnaA
  • pan gene symbol?: dnaA
  • synonym:
  • product: chromosomal replication initiation protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_00001
  • symbol: dnaA
  • product: chromosomal replication initiation protein
  • replicon: chromosome
  • strand: +
  • coordinates: 517..1878
  • length: 1362
  • essential: yes [1] DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    1321
    ATGTCGGAAAAAGAAATTTGGGAAAAAGTGCTTGAAATTGCTCAAGAAAAATTATCAGCT
    GTAAGTTACTCAACTTTCCTAAAAGATACTGAGCTTTACACGATTAAAGATGGTGAAGCT
    ATCGTATTATCGAGTATTCCTTTTAATGCAAATTGGTTAAATCAACAATATGCTGAAATT
    ATCCAAGCAATCTTATTTGATGTTGTAGGCTATGAAGTTAAACCTCACTTTATTACTACT
    GAAGAATTAGCAAATTATAGTAATAATGAAACTGCTACTCCAAAAGAAACAACAAAACCT
    TCTACTGAAACAACTGAGGATAATCATGTGCTTGGTAGAGAGCAATTCAATGCCCATAAC
    ACATTTGACACTTTTGTAATCGGACCCGGTAACCGCTTTCCACATGCAGCGAGTTTAGCT
    GTGGCCGAAGCACCAGCCAAAGCGTACAATCCATTATTTATCTATGGAGGTGTTGGTTTA
    GGAAAAACCCATTTAATGCATGCCATTGGTCATCATGTTTTAGATAATAATCCAGATGCC
    AAAGTGATTTACACATCAAGTGAAAAATTCACAAATGAATTTATTAAATCAATTCGTGAT
    AACGAAGGTGAAGCTTTCAGAGAAAGATATCGTAATATCGACGTCTTATTAATCGATGAT
    ATTCAGTTCATACAAAACAAGGTACAAACACAAGAAGAATTTTTCTATACTTTTAATGAA
    TTGCATCAGAATAACAAGCAAATAGTTATTTCGAGTGATCGACCACCAAAGGAAATTGCA
    CAATTAGAAGACCGATTACGTTCACGCTTTGAATGGGGGCTAATTGTTGATATTACGCCA
    CCAGATTATGAAACTCGAATGGCAATTTTGCAGAAGAAAATTGAAGAAGAAAAATTAGAT
    ATTCCACCAGAAGCTTTAAATTATATAGCAAATCAAATTCAATCTAATATTCGTGAATTA
    GAAGGTGCATTAACACGTTTACTTGCATATTCACAATTATTAGGAAAACCAATTACAACT
    GAATTAACTGCTGAAGCTTTAAAAGATATCATTCAAGCACCAAAATCTAAAAAGATTACC
    ATCCAAGATATTCAAAAAATTGTAGGCCAGTACTATAATGTTAGAATTGAAGATTTCAGT
    GCAAAAAAACGTACAAAGTCAATTGCATATCCGCGTCAAATAGCTATGTACTTGTCTAGA
    GAGCTTACAGATTTCTCATTACCTAAAATTGGTGAAGAATTTGGTGGGCGTGATCATACG
    ACCGTCATTCATGCTCATGAAAAAATATCTAAAGATTTAAAAGAAGATCCTATTTTTAAA
    CAAGAAGTAGAGAATCTTGAAAAAGAAATAAGAAATGTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1320
    1362

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_00001
  • symbol: DnaA
  • description: chromosomal replication initiation protein
  • length: 453
  • theoretical pI: 5.11626
  • theoretical MW: 51965.3
  • GRAVY: -0.488742

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairchromosomal replication initiator protein DnaA (TIGR00362; HMM-score: 594.7)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairDnaA regulatory inactivator Hda (TIGR03420; HMM-score: 115.2)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA polymerase III, delta subunit (TIGR01128; EC 2.7.7.7; HMM-score: 14.8)
    DNA repair and recombination protein RadB (TIGR02237; HMM-score: 12.6)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairHolliday junction DNA helicase RuvB (TIGR00635; EC 3.6.4.12; HMM-score: 12.1)
  • TheSEED:  
    DNA MetabolismDNA replicationDNA-replication Chromosomal replication initiator protein DnaA 
    Cell Division Subsystem including YidCD Chromosomal replication initiator protein DnaA 
  • PFAM:
    P-loop_NTPase (CL0023) Bac_DnaA; Bacterial dnaA protein (PF00308; HMM-score: 340.4)
    HTH (CL0123) Bac_DnaA_C; Bacterial dnaA protein helix-turn-helix (PF08299; HMM-score: 107.9)
    P-loop_NTPase (CL0023) IstB_IS21; IstB-like ATP binding protein (PF01695; HMM-score: 41.1)
    DnaA_N (CL0494) DnaA_N; DnaA N-terminal domain (PF11638; HMM-score: 31.4)
    P-loop_NTPase (CL0023) AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 29.8)
    ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 22.2)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 22)
    AFG1_ATPase; AFG1-like ATPase (PF03969; HMM-score: 18.3)
    DNA_pol3_delta; DNA polymerase III, delta subunit (PF06144; HMM-score: 16.1)
    AAA_22; AAA domain (PF13401; HMM-score: 14.4)
    AAA_19; AAA domain (PF13245; HMM-score: 14.1)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 12.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.101
    • Ymax_pos: 41
    • Cmax: 0.111
    • Cmax_pos: 59
    • Smax: 0.132
    • Smax_pos: 37
    • Smean: 0.069
    • D: 0.089
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSEKEIWEKVLEIAQEKLSAVSYSTFLKDTELYTIKDGEAIVLSSIPFNANWLNQQYAEIIQAILFDVVGYEVKPHFITTEELANYSNNETATPKETTKPSTETTEDNHVLGREQFNAHNTFDTFVIGPGNRFPHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHHVLDNNPDAKVIYTSSEKFTNEFIKSIRDNEGEAFRERYRNIDVLLIDDIQFIQNKVQTQEEFFYTFNELHQNNKQIVISSDRPPKEIAQLEDRLRSRFEWGLIVDITPPDYETRMAILQKKIEEEKLDIPPEALNYIANQIQSNIRELEGALTRLLAYSQLLGKPITTELTAEALKDIIQAPKSKKITIQDIQKIVGQYYNVRIEDFSAKKRTKSIAYPRQIAMYLSRELTDFSLPKIGEEFGGRDHTTVIHAHEKISKDLKEDPIFKQEVENLEKEIRNV

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]