From AureoWiki
Jump to: navigation, search

NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00024
  • pan locus tag?: SAUPAN000036000
  • symbol: SAOUHSC_00024
  • pan gene symbol?: walJ
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_00024
  • symbol: SAOUHSC_00024
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 29977..30777
  • length: 801
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGAGCCGCTTGATACGCATGAGTGTATTAGCAAGTGGTAGTACAGGTAACGCCACTTTT
    GTAGAAAATGAAAAAGGTAGTCTATTAGTTGATGTTGGTTTGACTGGAAAGAAAATGGAA
    GAATTGTTTAGTCAAATTGACCGTAATATTCAAGATTTAAATGGTATTTTAGTAACCCAT
    GAACATATTGATCATATTAAAGGATTAGGTGTTTTGGCGCGTAAATATCAATTGCCAATT
    TATGCGAATGAAAAAACTTGGCAGGCAATTGAAAAGAAAGATAGTCGCATCCCTATGGAT
    CAGAAATTCATTTTTAATCCTTATGAAACAAAATCTATTGCAGGTTTCGATGTTGAATCG
    TTTAACGTGTCACATGATGCAATAGATCCGCAATTTTATATTTTCCATAATAACTATAAG
    AAGTTTACGATTTTAACGGATACGGGTTACGTGTCTGATCGTATGAAAGGTATGATACGT
    GGCAGCGATGCGTTTATTTTTGAGAGTAATCATGACGTCGATATGTTGAGAATGTGTCGT
    TATCCATGGAAGACGAAACAACGTATTTTAGGCGATATGGGTCATGTATCTAATGAGGAT
    GCGGCTCATGCAATGACAGACGTGATTACAGGTAACACGAAACGTATTTACCTATCGCAT
    TTATCACAAGACAATAACATGAAAGATTTGGCGCGTATGAGTGTTGGCCAAGTATTGAAC
    GAACACGATATTGATACGGAAAAAGAAGTATTGCTATGTGATACGGATAAAGCTATTCCA
    ACGCCAATATATACAATATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    801

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_00024
  • symbol: SAOUHSC_00024
  • description: hypothetical protein
  • length: 266
  • theoretical pI: 6.34904
  • theoretical MW: 30327.4
  • GRAVY: -0.397368

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesDetoxificationhydroxyacylglutathione hydrolase (TIGR03413; EC 3.1.2.6; HMM-score: 33.5)
    Genetic information processingTranscriptionRNA processingribonuclease Z (TIGR02651; EC 3.1.26.11; HMM-score: 31.9)
    phosphonate metabolism protein PhnP (TIGR03307; HMM-score: 26.9)
    arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein (TIGR03675; HMM-score: 25.2)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOthercoenzyme PQQ biosynthesis protein B (TIGR02108; HMM-score: 23.5)
    Genetic information processingTranscriptionDegradation of RNAbeta-CASP ribonuclease, RNase J family (TIGR00649; EC 3.1.-.-; HMM-score: 23.3)
    Unknown functionEnzymes of unknown specificityquinoprotein relay system zinc metallohydrolase 1 (TIGR04558; HMM-score: 23.1)
    Unknown functionEnzymes of unknown specificityquinoprotein relay system zinc metallohydrolase 2 (TIGR04559; EC 3.-.-.-; HMM-score: 15.8)
    Signal transductionRegulatory functionsDNA interactionsheavy metal response regulator (TIGR01387; HMM-score: 12.7)
    Cellular processesCellular processesDNA transformationDNA internalization-related competence protein ComEC/Rec2 (TIGR00361; HMM-score: 11.6)
  • TheSEED:  
    Heme, hemin uptake and utilization systems in GramPositives Zn-dependent hydrolase YycJ/WalJ, required for cell wall metabolism and coordination of cell division with DNA replication 
  • PFAM:
    Metallo-HOrase (CL0381) Lactamase_B; Metallo-beta-lactamase superfamily (PF00753; HMM-score: 81.1)
    Lactamase_B_2; Beta-lactamase superfamily domain (PF12706; HMM-score: 73.6)
    Lactamase_B_6; Metallo-beta-lactamase superfamily domain (PF16661; HMM-score: 23.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.244
    • Ymax_pos: 11
    • Cmax: 0.151
    • Cmax_pos: 24
    • Smax: 0.74
    • Smax_pos: 1
    • Smean: 0.558
    • D: 0.366
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSRLIRMSVLASGSTGNATFVENEKGSLLVDVGLTGKKMEELFSQIDRNIQDLNGILVTHEHIDHIKGLGVLARKYQLPIYANEKTWQAIEKKDSRIPMDQKFIFNPYETKSIAGFDVESFNVSHDAIDPQFYIFHNNYKKFTILTDTGYVSDRMKGMIRGSDAFIFESNHDVDMLRMCRYPWKTKQRILGDMGHVSNEDAAHAMTDVITGNTKRIYLSHLSQDNNMKDLARMSVGQVLNEHDIDTEKEVLLCDTDKAIPTPIYTI

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  2. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]

Olivier Poupel, Mati Moyat, Julie Groizeleau, Luísa C S Antunes, Simonetta Gribaldo, Tarek Msadek, Sarah Dubrac
Transcriptional Analysis and Subcellular Protein Localization Reveal Specific Features of the Essential WalKR System in Staphylococcus aureus.
PLoS ONE: 2016, 11(3);e0151449
[PubMed:26999783] [WorldCat.org] [DOI] (I e)