From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000036000
  • symbol?: walJ
  • description?: beta-lactamase domain-containing protein

      descriptions from strain specific annotations:

    • beta-lactamase domain-containing protein
    • metallo-beta-lactamase family protein YycJ
    • Zn-dependent hydrolase (beta-lactamase superfamily)
    • metallo-beta-lactamase superfamily protein
    • metallo-beta-lactamase YycJ
    • metallo-beta-lactamase hydrolase
    • Beta-lactamase domain protein
    • YycJ protein
  • strand?: +
  • coordinates?: 36416..37217
  • synteny block?: BlockID0000330
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0023 (yycJ)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0022
    08BA02176:
    C248_0025 (yycJ)
    11819-97:
    MS7_0024
    71193:
    ST398NM01_0024
    ECT-R 2:
    ECTR2_24
    ED133:
    SAOV_0024 (yycJ)
    ED98:
    SAAV_0026 (yycJ)
    HO 5096 0412:
    SAEMRSA15_00220 (yycJ)
    JH1:
    SaurJH1_0022
    JH9:
    SaurJH9_0022
    JKD6008:
    SAA6008_00022 (yycJ)
    JKD6159:
    SAA6159_00022 (yycJ)
    LGA251:
    SARLGA251_00220 (yycJ)
    M013:
    M013TW_0025
    MRSA252:
    SAR0022 (yycJ)
    MSHR1132:
    SAMSHR1132_00230
    MSSA476:
    SAS0022
    Mu3:
    SAHV_0022
    Mu50:
    SAV0022
    MW2:
    MW0022
    RF122:
    SAB0022 (yycJ)
    ST398:
    SAPIG0024
    T0131:
    SAT0131_00024 (rpsA)
    TCH60:
    HMPREF0772_10446
    TW20:
    SATW20_00220 (yycJ)
    USA300_TCH1516:
    USA300HOU_0022
    VC40:
    SAVC_00110

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSRLIRMSVLASGSTGNATFVENEKGSLLVDVGLTGKKMEELFSQIDRNIQDLNGILVTH
    N315            MSRLIRMSVLASGSTGNATFVENEKGSLLVDVGLTGKKMEELFSQIDRNIQDLNGILVTH
    NCTC8325        MSRLIRMSVLASGSTGNATFVENEKGSLLVDVGLTGKKMEELFSQIDRNIQDLNGILVTH
    Newman          MSRLIRMSVLASGSTGNATFVENEKGSLLVDVGLTGKKMEELFSQIDRNIQDLNGILVTH
    USA300_FPR3757  MSRLIRMSVLASGSTGNATFVENEKGSLLVDVGLTGKKMEELFSQIDRNIQDLNGILVTH
                    ************************************************************

    COL             EHIDHIKGLGVLARKYQLPIYANEKTWQAIEKKDSRIPMDQKFIFNPYETKSIAGFDVES
    N315            EHIDHIKGLGVLARKYQLPIYANEKTWQAIEKKDSRIPMDQKFIFNPYETKSIAGFDVES
    NCTC8325        EHIDHIKGLGVLARKYQLPIYANEKTWQAIEKKDSRIPMDQKFIFNPYETKSIAGFDVES
    Newman          EHIDHIKGLGVLARKYQLPIYANEKTWQAIEKKDSRIPMDQKFIFNPYETKSIAGFDVES
    USA300_FPR3757  EHIDHIKGLGVLARKYQLPIYANEKTWQAIEKKDSRIPMDQKFIFNPYETKSIAGFDVES
                    ************************************************************

    COL             FNVSHDAIDPQFYIFHNNYKKFTILTDTGYVSDRMKGMIRGSDAFIFESNHDVDMLRMCR
    N315            FNVSHDAIDPQFYIFHNNYKKFTILTDTGYVSDRMKGMIRGSDAFIFESNHDVDMLRMCR
    NCTC8325        FNVSHDAIDPQFYIFHNNYKKFTILTDTGYVSDRMKGMIRGSDAFIFESNHDVDMLRMCR
    Newman          FNVSHDAIDPQFYIFHNNYKKFTILTDTGYVSDRMKGMIRGSDAFIFESNHDVDMLRMCR
    USA300_FPR3757  FNVSHDAIDPQFYIFHNNYKKFTILTDTGYVSDRMKGMIRGSDAFIFESNHDVDMLRMCR
                    ************************************************************

    COL             YPWKTKQRILGDMGHVSNEDAAHAMTDVITGNTKRIYLSHLSQDNNMKDLARMSVGQVLN
    N315            YPWKTKQRILGDMGHVSNEDAGHAMTDVITGNTKRIYLSHLSQDNNMKDLARMSVGQVLN
    NCTC8325        YPWKTKQRILGDMGHVSNEDAAHAMTDVITGNTKRIYLSHLSQDNNMKDLARMSVGQVLN
    Newman          YPWKTKQRILGDMGHVSNEDAAHAMTDVITGNTKRIYLSHLSQDNNMKDLARMSVGQVLN
    USA300_FPR3757  YPWKTKQRILGDMGHVSNEDAAHAMTDVITGNTKRIYLSHLSQDNNMKDLARMSVGQVLN
                    *********************.**************************************

    COL             EHDIDTEKEVLLCDTDKAIPTPIYTI
    N315            EHDIDTEKEVLLCDTDKAIPTPIYTI
    NCTC8325        EHDIDTEKEVLLCDTDKAIPTPIYTI
    Newman          EHDIDTEKEVLLCDTDKAIPTPIYTI
    USA300_FPR3757  EHDIDTEKEVLLCDTDKAIPTPIYTI
                    **************************