From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00090
  • pan locus tag?: SAUPAN000939000
  • symbol: SAOUHSC_00090
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_00090
  • symbol: SAOUHSC_00090
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 95415..96581
  • length: 1167
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    TTGAAAATTATATATTGTATTACTAAAGCAGACAATGGTGGTGCACAAACACATCTCATT
    CAACTCGCCAACCATTTTTGCGTACACAATGATGTTTATGTCATTGTAGGCAATCATGGA
    CCAATGATTGAACAACTAGATGCAAGAGTTAATGTAATTATTATCGAACATTTAGTAGGT
    CCAATTGACTTTAAACAAGATATTTTAGCTGTCAAAGTGTTAGCACAGTTATTCTCGAAA
    ATTAAACCTGATGTTATCCATTTACATTCTTCCAAAGCTGGAACGGTCGGACGAATTGCG
    AAGTTCATTTCGAAATCGAAAGACACACGTATAGTTTTTACTGCACATGGATGGGCTTTT
    ACAGAGGGTGTTAAACCAGCTAAAAAATTTCTATATTTAGTTATCGAAAAATTAATGTCA
    CTTATTACAGATAGCATTATTTGTGTTTCAGATTTCGATAAACAGTTAGCGTTAAAATAT
    CGATTTAATCGATTGAAATTAACCACAATACATAATGGTATTGCAGATGTTCCCGCTGTT
    AAGCAAACGCTAAAAAGCCAATCACATAACAATATTGGCGAAGTAGTTGGAATGTTGCCT
    AATAAACAAGATTTACAGATTAATGCCCCGACAAAGCATCAATTTGTTATGATTGCAAGA
    TTTGCTTATCCAAAATTGCCACAAAATCTAATCGCGGCAATAGAGATATTGAAATTACAT
    AACAGTAATCATGCGCATTTTACATTTATAGGCGATGGACCTACATTAAATGATTGTCAG
    CAACAAGTTGTACAAGCTGGGTTAGAAAATGATGTCACATTTTTGGGCAATGTCATTAAT
    GCGAGTCATTTATTATCACAATACGATACGTTTATTTTAATAAGTAAGCATGAAGGTTTG
    CCAATTAGCATTATAGAAGCTATGGCTACAGGTTTGCCTGTTATAGCCAGTCATGTTGGC
    GGTATTTCAGAATTAGTAGCTGATAATGGTATATGTATGATGAACAACCAACCCGAAACT
    ATTGCTAAAGTCCTGGAAAAATATTTAATAGACAGTGATTACATCAAAATGAGTAATCAA
    TCTAGAAAACGTTATTTAGAATGTTTTACTGAGGAGAAAATGATTAAAGAAGTGGAAGAC
    GTTTATAATGGAAAATCAACACAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1167

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_00090
  • symbol: SAOUHSC_00090
  • description: hypothetical protein
  • length: 388
  • theoretical pI: 8.1671
  • theoretical MW: 43233
  • GRAVY: 0.0270619

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    sugar transferase, PEP-CTERM/EpsH1 system associated (TIGR03088; HMM-score: 126.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersGlutathione and analogsN-acetyl-alpha-D-glucosaminyl L-malate synthase BshA (TIGR03999; EC 2.4.1.-; HMM-score: 96.4)
    glycosyltransferase, GG-Bacteroidales peptide system (TIGR04157; EC 2.4.1.-; HMM-score: 63.4)
    MetabolismEnergy metabolismBiosynthesis and degradation of polysaccharidesglycogen synthase, Corynebacterium family (TIGR02149; HMM-score: 50.5)
    PEP-CTERM/exosortase A-associated glycosyltransferase, Daro_2409 family (TIGR04063; EC 2.4.-.-; HMM-score: 47.3)
    D-inositol-3-phosphate glycosyltransferase (TIGR03449; EC 2.4.1.250; HMM-score: 39.4)
    MetabolismEnergy metabolismBiosynthesis and degradation of polysaccharidesglycogen/starch synthase, ADP-glucose type (TIGR02095; EC 2.4.1.21; HMM-score: 38)
    Unknown functionEnzymes of unknown specificityglycosyltransferase, MSMEG_0565 family (TIGR04047; HMM-score: 34.7)
    colanic acid biosynthesis glycosyltransferase WcaL (TIGR04005; EC 2.4.-.-; HMM-score: 30.6)
    sucrose-phosphate synthase, putative, glycosyltransferase domain (TIGR02472; EC 2.4.1.14; HMM-score: 29.8)
    putative glycosyltransferase, TIGR04348 family (TIGR04348; EC 2.4.1.-; HMM-score: 29.5)
    MetabolismEnergy metabolismBiosynthesis and degradation of polysaccharidessucrose synthase (TIGR02470; EC 2.4.1.13; HMM-score: 22.7)
    Genetic information processingProtein fateProtein modification and repairaccessory Sec system glycosylation protein GtfA (TIGR02918; EC 2.4.1.-; HMM-score: 20.5)
    colanic acid biosynthesis glycosyltransferase WcaC (TIGR04015; EC 2.4.-.-; HMM-score: 19.4)
    sucrose phosphate synthase (TIGR02468; EC 2.4.1.14; HMM-score: 16.7)
    sugar transferase, PEP-CTERM/EpsH1 system associated (TIGR03087; HMM-score: 14.3)
  • TheSEED:  
    Cell Wall and CapsuleCapsular and extracellular polysacchridesExopolysaccharide Biosynthesis Exopolysaccharide biosynthesis glycosyltransferase EpsF (EC 2.4.1.-) 
  • PFAM:
    GT-B (CL0113) Glycos_transf_1; Glycosyl transferases group 1 (PF00534; HMM-score: 93.9)
    Glyco_trans_1_4; Glycosyl transferases group 1 (PF13692; HMM-score: 86)
    Glyco_transf_4; Glycosyltransferase Family 4 (PF13439; HMM-score: 76.1)
    Glyco_trans_4_4; Glycosyl transferase 4-like domain (PF13579; HMM-score: 46.7)
    Glyco_trans_4_2; Glycosyl transferase 4-like (PF13477; HMM-score: 41.9)
    Glyco_trans_1_2; Glycosyl transferases group 1 (PF13524; HMM-score: 21.3)
    Glyco_transf_5; Starch synthase catalytic domain (PF08323; HMM-score: 16.7)
    HTH (CL0123) RuvB_C; Holliday junction DNA helicase ruvB C-terminus (PF05491; HMM-score: 15.6)
    no clan definedFAM153; FAM153 family (PF15722; HMM-score: 12.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.115
    • Ymax_pos: 23
    • Cmax: 0.121
    • Cmax_pos: 16
    • Smax: 0.159
    • Smax_pos: 20
    • Smean: 0.112
    • D: 0.114
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKIIYCITKADNGGAQTHLIQLANHFCVHNDVYVIVGNHGPMIEQLDARVNVIIIEHLVGPIDFKQDILAVKVLAQLFSKIKPDVIHLHSSKAGTVGRIAKFISKSKDTRIVFTAHGWAFTEGVKPAKKFLYLVIEKLMSLITDSIICVSDFDKQLALKYRFNRLKLTTIHNGIADVPAVKQTLKSQSHNNIGEVVGMLPNKQDLQINAPTKHQFVMIARFAYPKLPQNLIAAIEILKLHNSNHAHFTFIGDGPTLNDCQQQVVQAGLENDVTFLGNVINASHLLSQYDTFILISKHEGLPISIIEAMATGLPVIASHVGGISELVADNGICMMNNQPETIAKVLEKYLIDSDYIKMSNQSRKRYLECFTEEKMIKEVEDVYNGKSTQ

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]