From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000939000
  • symbol?:
  • description?: glycosyltransferase family 1 protein

      descriptions from strain specific annotations:

    • glycosyltransferase family 1 protein
    • glycosyl transferase, group 1 family protein
    • Exopolysaccharide biosynthesis glycosyltransferase EpsF
    • galactosyl transferase
    • beta-D-Glcp alpha-1,6-galactosyltransferase
    • capsular glycosyltransferase
    • glycoside hydrolase family protein
    • glycosyl transferases group 1 family protein
    • group 1 glycosyl transferase
  • strand?: +
  • coordinates?: 1199338..1200394
  • synteny block?: BlockID0004750
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0131
    08BA02176:
    C248_0119
    11819-97:
    MS7_0121
    71193:
    ST398NM01_0144
    ECT-R 2:
    ECTR2_86
    ED133:
    SAOV_0078
    ED98:
    SAAV_0098
    HO 5096 0412:
    SAEMRSA15_00970
    JH1:
    SaurJH1_0121
    JH9:
    SaurJH9_0116
    JKD6008:
    SAA6008_00108
    JKD6159:
    SAA6159_00113
    LGA251:
    SARLGA251_01050
    M013:
    M013TW_0120
    MRSA252:
    SAR0132
    MSHR1132:
    SAMSHR1132_01060
    MSSA476:
    SAS0104
    Mu3:
    SAHV_0129
    Mu50:
    SAV0130
    MW2:
    MW0104
    RF122:
    SAB0069 (cap8H)
    ST398:
    SAPIG0144
    T0131:
    SAT0131_00118 (xseA)
    TCH60:
    HMPREF0772_10368 (cap8H2)
    TW20:
    SATW20_01410
    USA300_TCH1516:
    USA300HOU_0142
    VC40:
    SAVC_00390

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIIYCITKADNGGAQTHLIQLANHFCVHNDVYVIVGNHGPMIEQLDARVNVIIIEHLVG
    N315            MKIIYCITKADNGGAQTHLIQLANHFCVHHDVYVIVGNHGPMIEQLDARVNVIILEHLVG
    NCTC8325        MKIIYCITKADNGGAQTHLIQLANHFCVHNDVYVIVGNHGPMIEQLDARVNVIIIEHLVG
    Newman          MKIIYCITKADNGGAQTHLIQLANHFCVHNDVYVIVGNHGPMIEQLDARVNVIIIEHLVG
    USA300_FPR3757  MKIIYCITKADNGGAQTHLIQLANHFCVHNDVYVIVGNHGPMIEQLDARVNVIIIEHLVG
                    *****************************:************************:*****

    COL             PIDFKQDILAVKVLAQLFSKIKPDVIHLHSSKAGTVGRIAKFISKSKDTRIVFTAHGWAF
    N315            PIDFKQDILAVKVLAQLFSKIKPDVIHLHSSKAGTVGRIAKFISKSKDTRVVFTAHGWAF
    NCTC8325        PIDFKQDILAVKVLAQLFSKIKPDVIHLHSSKAGTVGRIAKFISKSKDTRIVFTAHGWAF
    Newman          PIDFKQDILAVKVLAQLFSKIKPDVIHLHSSKAGTVGRIAKFISKSKDTRIVFTAHGWAF
    USA300_FPR3757  PIDFKQDILAVKVLAQLFSKIKPDVIHLHSSKAGTVGRIAKFISKSKDTRIVFTAHGWAF
                    **************************************************:*********

    COL             TEGVKPAKKFLYLVIEKLMSLITDSIICVSDFDKQLALKYRFNRLKLTTIHNGIADVPAV
    N315            TEGVKPAKKFLYLVIEKLMSCITDSIICVSDFDKQLALKYRFNRLKLTTIHNGIADVPAV
    NCTC8325        TEGVKPAKKFLYLVIEKLMSLITDSIICVSDFDKQLALKYRFNRLKLTTIHNGIADVPAV
    Newman          TEGVKPAKKFLYLVIEKLMSLITDSIICVSDFDKQLALKYRFNRLKLTTIHNGIADVPAV
    USA300_FPR3757  TEGVKPAKKFLYLVIEKLMSLITDSIICVSDFDKQLALKYRFNRLKLTTIHNGIADVPAV
                    ******************** ***************************************

    COL             KQTLKSQSHNNIGEVVGMLPNKQDLQINAPTKHQFVMIARFAYPKLPQNLIAAIEILKLH
    N315            KQTLKSQSHNNIGEVVGMLPNKQDLQINAPTKHQFVMIARFAYPKLPQNLIAAIEILKLH
    NCTC8325        KQTLKSQSHNNIGEVVGMLPNKQDLQINAPTKHQFVMIARFAYPKLPQNLIAAIEILKLH
    Newman          KQTLKSQSHNNIGEVVGMLPNKQDLQINAPTKHQFVMIARFAYPKLPQNLIAAIEILKLH
    USA300_FPR3757  KQTLKSQSHNNIGEVVGMLPNKQDLQINAPTKHQFVMIARFAYPKLPQNLIAAIEILKLH
                    ************************************************************

    COL             NSNHAHFTFIGDGPTLNDCQQQVVQAGLENDVTFLGNVINASHLLSQYDTFILISKHEGL
    N315            NSNHAHFTFIGDGPTLNDCQQQVVQAGLENDVTFLGNVINASHLLSQYDTFILISKHEGL
    NCTC8325        NSNHAHFTFIGDGPTLNDCQQQVVQAGLENDVTFLGNVINASHLLSQYDTFILISKHEGL
    Newman          NSNHAHFTFIGDGPTLNDCQQQVVQAGLENDVTFLGNVINASHLLSQYDTFILISKHEGL
    USA300_FPR3757  NSNHAHFTFIGDGPTLNDCQQQVVQAGLENEVTFLGNVINASHLLSQYDTFILISKHEGL
                    ******************************:*****************************

    COL             PISIIEAMATGLPVIASHVGGISELVADNGICMMNNQPETIAKVLEKYLIDSDYIKMSNQ
    N315            PISIIEAMATGLPVIASHVGGISELVADNGICMMNNQPETIAKVLEKYLIDSDYIKMSNQ
    NCTC8325        PISIIEAMATGLPVIASHVGGISELVADNGICMMNNQPETIAKVLEKYLIDSDYIKMSNQ
    Newman          PISIIEAMATGLPVIASHVGGISELVADNGICMMNNQPETIAKVLEKYLIDSDYIKMSNQ
    USA300_FPR3757  PISIIEAMATGLPVIASHVGGISELVADNGICMMNNQPETIAKVLEKYLIDSDYIKMSNQ
                    ************************************************************

    COL             SRKRYLECFTEEKMIKEVEDVYNGKSTQ
    N315            SRKRYLECFTEEKMIKEVEDVYNGKSTQ
    NCTC8325        SRKRYLECFTEEKMIKEVEDVYNGKSTQ
    Newman          SRKRYLECFTEEKMIKEVEDVYNGKSTQ
    USA300_FPR3757  SRKRYLECFTEEKMIKEVEDVYNGKSTQ
                    ****************************