From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00257
  • pan locus tag?: SAUPAN001175000
  • symbol: SAOUHSC_00257
  • pan gene symbol?: esxA
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_00257
  • symbol: SAOUHSC_00257
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 275931..276224
  • length: 294
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    ATGGCAATGATTAAGATGAGTCCAGAGGAAATCAGAGCAAAATCGCAATCTTACGGGCAA
    GGTTCAGACCAAATCCGTCAAATTTTATCTGATTTAACACGTGCACAAGGTGAAATTGCA
    GCGAACTGGGAAGGTCAAGCTTTCAGCCGTTTCGAAGAGCAATTCCAACAACTTAGTCCT
    AAAGTAGAAAAATTTGCACAATTATTAGAAGAAATTAAACAACAATTGAATAGCACTGCT
    GATGCCGTTCAAGAACAAGACCAACAACTTTCTAATAATTTCGGTTTGCAATAA
    60
    120
    180
    240
    294

Protein[edit source | edit]

Protein Data Bank: 2VRZ
Protein Data Bank: 2VS0

General[edit source | edit]

  • locus tag: SAOUHSC_00257
  • symbol: SAOUHSC_00257
  • description: hypothetical protein
  • length: 97
  • theoretical pI: 4.32285
  • theoretical MW: 11036.2
  • GRAVY: -0.765979

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    WXG100 family type VII secretion target (TIGR03930; HMM-score: 80.2)
    type VII secretion effector, TIGR04197 family (TIGR04197; HMM-score: 20.8)
    two transmembrane protein (TIGR04527; HMM-score: 18.8)
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 13.3)
    Genetic information processingProtein fateProtein folding and stabilizationprefoldin, alpha subunit (TIGR00293; HMM-score: 10.3)
  • TheSEED:  
    Membrane TransportProtein secretion system, Type VIIESAT-6 proteins secretion system in Firmicutes 6 kDa early secretory antigenic target ESAT-6 (EsxA) 
  • PFAM:
    EsxAB (CL0352) WXG100; Proteins of 100 residues with WXG (PF06013; HMM-score: 78.1)
    T7SS_ESX_EspC; Excreted virulence factor EspC, type VII ESX diderm (PF10824; HMM-score: 19.3)
    no clan definedApolipoprotein; Apolipoprotein A1/A4/E domain (PF01442; HMM-score: 18.7)
    EzrA; Septation ring formation regulator, EzrA (PF06160; HMM-score: 18.3)
    KxDL; Uncharacterized conserved protein (PF10241; HMM-score: 18.3)
    DUF2130; Uncharacterized protein conserved in bacteria (DUF2130) (PF09903; HMM-score: 17.4)
    IFT57; Intra-flagellar transport protein 57 (PF10498; HMM-score: 16.8)
    Med2; Mediator complex subunit 2 (PF11214; HMM-score: 16.6)
    TSNAXIP1_N; Translin-associated factor X-interacting N-terminus (PF15739; HMM-score: 16.6)
    Filament; Intermediate filament protein (PF00038; HMM-score: 15.9)
    Tup_N; Tup N-terminal (PF08581; HMM-score: 15.8)
    Cast; RIM-binding protein of the cytomatrix active zone (PF10174; HMM-score: 15.7)
    ING; Inhibitor of growth proteins N-terminal histone-binding (PF12998; HMM-score: 15.1)
    Phage_30_3; Bacteriophage protein GP30.3 (PF08010; HMM-score: 15)
    DNA_repr_REX1B; DNA repair REX1-B (PF14966; HMM-score: 15)
    LXG; LXG domain of WXG superfamily (PF04740; HMM-score: 14.8)
    Mobilization_B; Mobilization protein B (PF17511; HMM-score: 14.8)
    PDDEXK (CL0236) RmuC; RmuC family (PF02646; HMM-score: 14.7)
    no clan definedCK2S; Casein Kinase 2 substrate (PF15011; HMM-score: 14.6)
    TRPM_tetra; Tetramerisation domain of TRPM (PF16519; HMM-score: 14.6)
    DUF5344; Family of unknown function (DUF5344) (PF17279; HMM-score: 14.6)
    Skp1; Skp1 family, dimerisation domain (PF01466; HMM-score: 13.6)
    Cytochrom_B562; Cytochrome b562 (PF07361; HMM-score: 12.6)
    MscS_porin; Mechanosensitive ion channel porin domain (PF12795; HMM-score: 11.9)
    OML_zippers (CL0590) LPP; Lipoprotein leucine-zipper (PF04728; HMM-score: 11.7)
    no clan definedUPF0449; Uncharacterised protein family UPF0449 (PF15136; HMM-score: 11.7)
    FapA; Flagellar Assembly Protein A (PF03961; HMM-score: 10.8)
    TMPIT; TMPIT-like protein (PF07851; HMM-score: 10.5)
    KNOX2; KNOX2 domain (PF03791; HMM-score: 10.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 10
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.117
    • Ymax_pos: 14
    • Cmax: 0.128
    • Cmax_pos: 41
    • Smax: 0.176
    • Smax_pos: 3
    • Smean: 0.116
    • D: 0.116
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-3661
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]