From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00324
  • pan locus tag?: SAUPAN001881000
  • symbol: SAOUHSC_00324
  • pan gene symbol?:
  • synonym:
  • product: 50S ribosomal protein L7 serine acetyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_00324
  • symbol: SAOUHSC_00324
  • product: 50S ribosomal protein L7 serine acetyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 337067..337612
  • length: 546
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGTTTGGAATGAAAGTGAATGAACAAATAACATTAAAAATTTTAGAAGCTCATGACACA
    GAAGCGCTTTTCAATTTAGTCAATCGTTCAAGAAATTCACTTAGGGAATGGTTACCTTGG
    GTAGATGCAACTGAGCAACCATCAGATACGCGTGCATTTATTAAAAGAGGACTTTTGCAA
    TTTGCTGATGGTAATGGATTTCAGTGTGGCATTTGGTATGAAGGAACGCTAGTTGGTGTC
    ATCGGTTTACATGAAATTAATCACATGCACAGAAAAACTTCATTAGGGTACTATTTAGAT
    AAAGAATTTGAGGGTCATGGGATTATGACACAAGCAGTTGAGGCATTGATAAAGTATTGT
    TTCGAAGAGCTTGACTTAAACCGAATTGAGATTAGTGCCGCAGTTAATAATGAAAAAAGC
    CGGGCTATTCCTGAAAGGCTGGGATTTACTAGAGAAGGTATGTTACGTGACAATGAATTA
    CTAAATGGTATTTATTCATCGAGTTACATCTATAGTTTATTAAAATCAGAATACGACCAA
    AAATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    546

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_00324
  • symbol: SAOUHSC_00324
  • description: 50S ribosomal protein L7 serine acetyltransferase
  • length: 181
  • theoretical pI: 5.32637
  • theoretical MW: 20856.5
  • GRAVY: -0.366851

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine N-acetyltransferase (TIGR03585; EC 2.3.1.202; HMM-score: 43.3)
    Cellular processesCellular processesToxin production and resistanceaminoglycoside N(6')-acetyltransferase, AacA4 family (TIGR04431; EC 2.3.1.82; HMM-score: 21)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal-protein-alanine acetyltransferase (TIGR01575; EC 2.3.1.128; HMM-score: 13.5)
  • TheSEED:  
    Protein MetabolismProtein biosynthesisRibosome biogenesis bacterial Ribosomal-protein-L7p-serine acetyltransferase 
    Protein processing and modificationRibosomal protein S5p acylation Ribosomal-protein-L7p-serine acetyltransferase 
  • PFAM:
    Acetyltrans (CL0257) Acetyltransf_3; Acetyltransferase (GNAT) domain (PF13302; HMM-score: 88.9)
    Acetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 50.2)
    Acetyltransf_4; Acetyltransferase (GNAT) domain (PF13420; HMM-score: 40.8)
    Acetyltransf_8; Acetyltransferase (GNAT) domain (PF13523; HMM-score: 27.3)
    Acetyltransf_10; Acetyltransferase (GNAT) domain (PF13673; HMM-score: 19.8)
    FR47; FR47-like protein (PF08445; HMM-score: 13.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.132
    • Ymax_pos: 18
    • Cmax: 0.12
    • Cmax_pos: 53
    • Smax: 0.254
    • Smax_pos: 17
    • Smean: 0.15
    • D: 0.139
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MFGMKVNEQITLKILEAHDTEALFNLVNRSRNSLREWLPWVDATEQPSDTRAFIKRGLLQFADGNGFQCGIWYEGTLVGVIGLHEINHMHRKTSLGYYLDKEFEGHGIMTQAVEALIKYCFEELDLNRIEISAAVNNEKSRAIPERLGFTREGMLRDNELLNGIYSSSYIYSLLKSEYDQK

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]