From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001881000
  • symbol?:
  • description?: RimJ/RimL family protein N-acetyltransferase

      descriptions from strain specific annotations:

    • RimJ/RimL family protein N-acetyltransferase
    • ribosomal-protein-serine acetyltransferase
    • 50S ribosomal protein L7 serine acetyltransferase
    • acetyltransferase
    • Ribosomal-protein-L7p-serine acetyltransferase
    • acetyltransferase (GNAT) family protein
    • N-acetyltransferase GCN5
    • putative acetyltransferase
    • putative ribosomal N-acetyltransferase YdaF
    • ribosomal-protein-serine acetyltransferase, putative
    • ribosomal-protein-serine N-acetyltransferase
  • strand?: +
  • coordinates?: 2372029..2372574
  • synteny block?: BlockID0012550
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0340
    08BA02176:
    C248_0397
    11819-97:
    MS7_0332 (ydaF)
    71193:
    ST398NM01_0423
    ECT-R 2:
    ECTR2_302
    ED133:
    SAOV_0366
    ED98:
    SAAV_0310
    HO 5096 0412:
    SAEMRSA15_02970
    JH1:
    SaurJH1_0400
    JH9:
    SaurJH9_0390
    JKD6008:
    SAA6008_00319
    JKD6159:
    SAA6159_00316
    LGA251:
    SARLGA251_03020
    M013:
    M013TW_0321
    MRSA252:
    SAR0339
    MSHR1132:
    SAMSHR1132_03150
    MSSA476:
    SAS0318
    Mu3:
    SAHV_0339
    Mu50:
    SAV0342
    MW2:
    MW0318
    RF122:
    SAB0292
    ST398:
    SAPIG0423
    T0131:
    SAT0131_00347 (engB)
    TCH60:
    HMPREF0772_10152
    TW20:
    SATW20_04100
    USA300_TCH1516:
    USA300HOU_0363
    VC40:
    SAVC_01460

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFGMKVNEQITLKILEAHDTEALFNLVNRSRNSLREWLPWVDATEQPSDTRAFIKRGLLQ
    N315            MFGMKVNEQITLKILEAHDTEALFNLVNRSRNSLREWLPWVDATEQPSDTRAFIKRGLLQ
    NCTC8325        MFGMKVNEQITLKILEAHDTEALFNLVNRSRNSLREWLPWVDATEQPSDTRAFIKRGLLQ
    Newman          MFGMKVNEQITLKILEAHDTEALFNLVNRSRNSLREWLPWVDATEQPSDTRAFIKRGLLQ
    USA300_FPR3757  MFGMKVNEQITLKILEAHDTEALFNLVNRSRNSLREWLPWVDATEQPSDTRAFIKRGLLQ
                    ************************************************************

    COL             FADGNGFQCGIWYEGTLVGVIGLHEINHMHRKTSLGYYLDKEFEGHGIMTQAVEALIKYC
    N315            FADGNGFQCGIWYEGTLVGVIGLHEINHMHRKTSLGYYLDKQFEGHGIMTQAVEALIKYC
    NCTC8325        FADGNGFQCGIWYEGTLVGVIGLHEINHMHRKTSLGYYLDKEFEGHGIMTQAVEALIKYC
    Newman          FADGNGFQCGIWYEGTLVGVIGLHEINHMHRKTSLGYYLDKEFEGHGIMTQAVEALIKYC
    USA300_FPR3757  FADGNGFQCGIWYEGTLVGVIGLHEINHMHRKTSLGYYLDKEFEGHGIMTQAVEALIKYC
                    *****************************************:******************

    COL             FEELDLNRIEISAAVNNEKSRAIPERLGFTREGMLRDNELLNGIYSSSYIYSLLKSEYDQ
    N315            FEELDLNRIEISAAVNNEKSRAIPERLGFTREGMLRDNELLNGIYSSSYIYSLLKSEYDQ
    NCTC8325        FEELDLNRIEISAAVNNEKSRAIPERLGFTREGMLRDNELLNGIYSSSYIYSLLKSEYDQ
    Newman          FEELDLNRIEISAAVNNEKSRAIPERLGFTREGMLRDNELLNGIYSSSYIYSLLKSEYDQ
    USA300_FPR3757  FEELDLNRIEISAAVNNEKSRAIPERLGFTREGMLRDNELLNGIYSSSYIYSLLKSEYDQ
                    ************************************************************

    COL             K
    N315            K
    NCTC8325        K
    Newman          K
    USA300_FPR3757  K
                    *