From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00612
  • pan locus tag?: SAUPAN002475000
  • symbol: SAOUHSC_00612
  • pan gene symbol?:
  • synonym:
  • product: endonuclease III

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_00612
  • symbol: SAOUHSC_00612
  • product: endonuclease III
  • replicon: chromosome
  • strand: +
  • coordinates: 604016..604651
  • length: 636
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGTTAGGAACTGATGAATTATATAAAGTTTTATATGAACATCTCGGACCACAATTTTGG
    TGGCCTGCTGATAATGACATTGAAATGATGTTAGGTGCAATTTTAGTTCAAAATACTAGA
    TGGCGAAATGCAGAAATTGCATTGAATCAGATTAAAGAACATACGCATTTTAATCCAAAT
    CATATATTAGAACTACCTATTGAAACGTTACAATCATTGATACATTCAAGTGGCTTTTAT
    AAAAGTAAATCACTGACGATTAAAACATTATTAACATGGTTAGCACGACATCATTTCAAT
    TATCAAGAGATTAATGAGCGATATAAAGGTGGATTAAGAAAAGAATTATTATCTTTGAAA
    GGTATTGGAAGTGAAACAGCAGATGTCTTACTTGTTTATATATTCGGACGTATTGAATTT
    ATTCCAGATAGCTATACAAGAAAAATATATGATAAATTAGGATATGAAAACACTAAAAAT
    TATGATCAATTAAAAAAAGTAGTCACATTACCAAATCATTTTACAAATCAAGATGCTAAT
    GAATTTCATGCTCTGTTAGATGTATTTGGTAAACATTACTTTAGAGACAAAGATATAAAG
    AATTATGATTTTTTAGAACCTTACTTTAAAAAGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    636

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_00612
  • symbol: SAOUHSC_00612
  • description: endonuclease III
  • length: 211
  • theoretical pI: 7.4149
  • theoretical MW: 25016.4
  • GRAVY: -0.492417

Function[edit source | edit]

  • reaction:
    EC 4.2.99.18?  ExPASy
    DNA-(apurinic or apyrimidinic site) lyaseThe C-O-P bond 3' to the apurinic or apyrimidinic site in DNA is broken by a beta-elimination reaction, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'-phosphate
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairendonuclease III (TIGR01083; EC 4.2.99.18; HMM-score: 46.9)
    Genetic information processingDNA metabolismDNA replication, recombination, and repair8-oxoguanine DNA-glycosylase (ogg) (TIGR00588; EC 3.2.2.-; HMM-score: 16)
  • TheSEED:  
    DNA MetabolismDNA repairDNA Repair Base Excision Endonuclease III (EC 4.2.99.18) 
  • PFAM:
    HHH (CL0198) HhH-GPD; HhH-GPD superfamily base excision DNA repair protein (PF00730; HMM-score: 32.2)
    HHH; Helix-hairpin-helix motif (PF00633; HMM-score: 21.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: [4Fe-4S] cluster
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.111
    • Ymax_pos: 50
    • Cmax: 0.154
    • Cmax_pos: 23
    • Smax: 0.21
    • Smax_pos: 43
    • Smean: 0.065
    • D: 0.093
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MLGTDELYKVLYEHLGPQFWWPADNDIEMMLGAILVQNTRWRNAEIALNQIKEHTHFNPNHILELPIETLQSLIHSSGFYKSKSLTIKTLLTWLARHHFNYQEINERYKGGLRKELLSLKGIGSETADVLLVYIFGRIEFIPDSYTRKIYDKLGYENTKNYDQLKKVVTLPNHFTNQDANEFHALLDVFGKHYFRDKDIKNYDFLEPYFKK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]