From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01074
  • pan locus tag?: SAUPAN003351000
  • symbol: SAOUHSC_01074
  • pan gene symbol?: rsmD
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01074
  • symbol: SAOUHSC_01074
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1038980..1039450
  • length: 471
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGGATAAAGTTAAAGAAGGTATCTTTAATAGTTTATATGATGTGTCAGGTATAGGTTTA
    GATTTATTTGCAGGAAGCGGGGCGCTTGGAATAGAAGCACTCTCTCGAGGTATGGATAAG
    GTAATCTTTGTTGATCAAAATTTTAAAGCTGTAAAAGTTATTAAATCAAATCTTGCGAAT
    TTGGATTTAGAGGCACAATCTGAAGTTTATAAAAATAATGCAGATAGAGCTTTAAAAGCA
    TTGTCAAAACGTGATATTCAATTTGATGTCATTTTCTTAGATCCACCTTATAATAAAGGT
    CTCATTGATAAAGCTTTAAAACTAATTTCAGAGTTTAATTTATTGAAAGAAAATGGTATC
    ATCGTTTGTGAATTTAGCAATCATGAAGAAATAGATTATCAACCGTTTAATATGATTAAA
    CGTTACCATTATGGGTTGACAGACACATTGTTATTAGAAAAGGGAGAATAG
    60
    120
    180
    240
    300
    360
    420
    471

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01074
  • symbol: SAOUHSC_01074
  • description: hypothetical protein
  • length: 156
  • theoretical pI: 4.84693
  • theoretical MW: 17566.1
  • GRAVY: -0.136538

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesistRNA and rRNA base modification16S rRNA (guanine(966)-N(2))-methyltransferase RsmD (TIGR00095; EC 2.1.1.171; HMM-score: 142)
    Genetic information processingProtein fateProtein modification and repairprotein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 34.6)
    Genetic information processingProtein fateProtein modification and repairmethyltransferase, HemK family (TIGR00536; HMM-score: 33.9)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationprotein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (TIGR03533; EC 2.1.1.-; HMM-score: 31)
    Genetic information processingProtein synthesistRNA and rRNA base modification23S rRNA (uracil-5-)-methyltransferase RumA (TIGR00479; EC 2.1.1.-; HMM-score: 27.7)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminprecorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 26.4)
    Genetic information processingProtein synthesistRNA and rRNA base modificationN2,N2-dimethylguanosine tRNA methyltransferase (TIGR00308; EC 2.1.1.-; HMM-score: 24.7)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein L11 methyltransferase (TIGR00406; EC 2.1.1.-; HMM-score: 23.5)
    Genetic information processingDNA metabolismRestriction/modificationtype II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family (TIGR02987; EC 2.1.1.72; HMM-score: 20.7)
    Hypothetical proteinsConservedputative methyltransferase, TIGR01177 family (TIGR01177; HMM-score: 20.5)
    Unknown functionEnzymes of unknown specificityputative methylase (TIGR00537; HMM-score: 14.9)
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA (uracil(54)-C(5))-methyltransferase (TIGR02143; EC 2.1.1.35; HMM-score: 13.4)
  • TheSEED:  
    CBSS-269801.1.peg.1715 16S rRNA (guanine(966)-N(2))-methyltransferase (EC 2.1.1.171) 
  • PFAM:
    NADP_Rossmann (CL0063) Cons_hypoth95; Conserved hypothetical protein 95 (PF03602; HMM-score: 141.8)
    MTS; Methyltransferase small domain (PF05175; HMM-score: 37.3)
    Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 30.6)
    Methyltransf_15; RNA cap guanine-N2 methyltransferase (PF09445; HMM-score: 27.1)
    MethyltransfD12; D12 class N6 adenine-specific DNA methyltransferase (PF02086; HMM-score: 26.6)
    TRM; N2,N2-dimethylguanosine tRNA methyltransferase (PF02005; HMM-score: 25.2)
    Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 23.1)
    PrmA; Ribosomal protein L11 methyltransferase (PrmA) (PF06325; HMM-score: 21.6)
    Methyltransf_24; Methyltransferase domain (PF13578; HMM-score: 18.9)
    UPF0020; Putative RNA methylase family UPF0020 (PF01170; HMM-score: 16.1)
    N6_N4_Mtase; DNA methylase (PF01555; HMM-score: 15.9)
    RsmJ; Ribosomal RNA large subunit methyltransferase D, RlmJ (PF04378; HMM-score: 15.7)
    Methyltr_RsmB-F; 16S rRNA methyltransferase RsmB/F (PF01189; HMM-score: 14.3)
    Methyltransf_16; Lysine methyltransferase (PF10294; HMM-score: 13.7)
    tRNA_U5-meth_tr; tRNA (Uracil-5-)-methyltransferase (PF05958; HMM-score: 13.3)
    Methyltransf_3; O-methyltransferase (PF01596; HMM-score: 13.2)
    Met_10; Met-10+ like-protein (PF02475; HMM-score: 13.2)
    Spermine_synth; Spermine/spermidine synthase domain (PF01564; HMM-score: 13.1)
    N6-adenineMlase; Probable N6-adenine methyltransferase (PF10237; HMM-score: 13)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.127
    • Ymax_pos: 34
    • Cmax: 0.134
    • Cmax_pos: 45
    • Smax: 0.174
    • Smax_pos: 24
    • Smean: 0.095
    • D: 0.114
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MDKVKEGIFNSLYDVSGIGLDLFAGSGALGIEALSRGMDKVIFVDQNFKAVKVIKSNLANLDLEAQSEVYKNNADRALKALSKRDIQFDVIFLDPPYNKGLIDKALKLISEFNLLKENGIIVCEFSNHEEIDYQPFNMIKRYHYGLTDTLLLEKGE

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  2. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]