From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003351000
  • symbol?: rsmD
  • description?: methyltransferase

      descriptions from strain specific annotations:

    • methyltransferase
    • Ribosomal RNA small subunit methyltransferase D
    • methyltransferase small domain-containing protein
    • RsmD family RNA methyltransferase
    • site-specific DNA-methyltransferase (adenine-specific)
    • putative methylase
    • RNA methyltransferase, RsmD family
  • strand?: +
  • coordinates?: 3717696..3718247
  • synteny block?: BlockID0024350
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1080
    08BA02176:
    C248_1150
    11819-97:
    MS7_1080
    71193:
    ST398NM01_1120
    ECT-R 2:
    ECTR2_978
    ED133:
    SAOV_1065
    ED98:
    SAAV_1090
    HO 5096 0412:
    SAEMRSA15_09530
    JH1:
    SaurJH1_1205
    JH9:
    SaurJH9_1183
    JKD6008:
    SAA6008_01078
    JKD6159:
    SAA6159_00978
    LGA251:
    SARLGA251_10360
    M013:
    M013TW_1055
    MRSA252:
    SAR1097
    MSHR1132:
    SAMSHR1132_09700
    MSSA476:
    SAS1058
    Mu3:
    SAHV_1115
    Mu50:
    SAV1124
    MW2:
    MW1006
    RF122:
    SAB0988
    ST398:
    SAPIG1120 (rsmD)
    T0131:
    SAT0131_01162
    TCH60:
    HMPREF0772_12109
    TW20:
    SATW20_11180
    USA300_TCH1516:
    USA300HOU_1061
    VC40:
    SAVC_04780

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRVIAGKHKSKALESMEGRNTRPTMDKVKEGIFNSLYDVSGIGLDLFAGSGALGIEALSR
    N315            MRVIAGKHKSKALESMEGRNTRPTMDKVKEGIFNSLYDVSGIGLDLFAGSGALGIEALSR
    NCTC8325        ------------------------MDKVKEGIFNSLYDVSGIGLDLFAGSGALGIEALSR
    Newman          MRVIAGKHKSKALESMEGRNTRPTMDKVKEGIFNSLYDVSGIGLDLFAGSGALGIEALSR
    USA300_FPR3757  MRVIAGKHKSKALESMEGRNTRPTMDKVKEGIFNSLYDVSGIGLDLFAGSGALGIEALSR
                                            ************************************

    COL             GMDKVIFVDQNFKAVKVIKSNLANLDLEAQSEVYKNNADRALKALSKRDIQFDVIFLDPP
    N315            GMDKVIFVDQNFKAVKVIKSNLANLDLEAQSEVYKNNADRALKALSKRDIQFDVIFLDPP
    NCTC8325        GMDKVIFVDQNFKAVKVIKSNLANLDLEAQSEVYKNNADRALKALSKRDIQFDVIFLDPP
    Newman          GMDKVIFVDQNFKAVKVIKSNLANLDLEAQSEVYKNNADRALKALSKRDIQFDVIFLDPP
    USA300_FPR3757  GMDKVIFVDQNFKAVKVIKSNLANLDLEAQSEVYKNNADRALKALSKRDIQFDVIFLDPP
                    ************************************************************

    COL             YNKGLIDKALKLISEFNLLKENGIIVCEFSNHEEIDYQPFNMIKRYHYGLTDTLLLEKGE
    N315            YNKGLIDKALKLISEFNLLKENGIIVCEFSNHEEIDYQPFNMIKRYHYGLTDTLLLEKGE
    NCTC8325        YNKGLIDKALKLISEFNLLKENGIIVCEFSNHEEIDYQPFNMIKRYHYGLTDTLLLEKGE
    Newman          YNKGLIDKALKLISEFNLLKENGIIVCEFSNHEEIDYQPFNMIKRYHYGLTDTLLLEKGE
    USA300_FPR3757  YNKGLIDKALKLISEFNLLKENGIIVCEFSNHEEIDYQPFNMIKRYHYGLTDTLLLEKGE
                    ************************************************************