From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01123
  • pan locus tag?: SAUPAN003421000
  • symbol: SAOUHSC_01123
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01123
  • symbol: SAOUHSC_01123
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1078148..1078372
  • length: 225
  • essential: no [1] DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    TTGTTAATTCAAGAAAGGGGATTAAAAATGACAGAGTTGAATAATATTATAAACTCTCTT
    CAATCTTTGTTTGAGTCTGAATCAGGCTATAAAATTTCGAAAAATTCAGGAGTTCCATAT
    CAAACAGTACAAGATTTAAGAAATGGGAAAACCAAACTAGAAGATGCTAGATTTAGAACG
    ATTATTAAACTTTATAGTTACTATGTCTCATTAAAAGAACACTAA
    60
    120
    180
    225

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01123
  • symbol: SAOUHSC_01123
  • description: hypothetical protein
  • length: 74
  • theoretical pI: 9.73497
  • theoretical MW: 8629.83
  • GRAVY: -0.566216

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    FIG01108126: hypothetical protein 
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 13.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.136
    • Ymax_pos: 11
    • Cmax: 0.111
    • Cmax_pos: 31
    • Smax: 0.252
    • Smax_pos: 2
    • Smean: 0.187
    • D: 0.156
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MLIQERGLKMTELNNIINSLQSLFESESGYKISKNSGVPYQTVQDLRNGKTKLEDARFRTIIKLYSYYVSLKEH

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]