From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003421000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 3772500..3772725
  • synteny block?: BlockID0025020
  • occurrence?: in 91% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1120
    08BA02176:
    C248_1191
    11819-97:
    MS7_1120
    71193:
    ST398NM01_1159
    ECT-R 2:
    ECTR2_1019
    ED133:
    SAOV_1163
    ED98:
    SAAV_1133
    HO 5096 0412:
    SAEMRSA15_09960
    JH1:
    SaurJH1_1248
    JH9:
    SaurJH9_1223
    JKD6008:
    SAA6008_01117
    JKD6159:
    SAA6159_01015
    LGA251:
    SARLGA251_10740
    M013:
    M013TW_1096
    MRSA252:
    SAR1137
    MSHR1132:
    SAMSHR1132_10060
    MSSA476:
    SAS1098
    Mu3:
    SAHV_1154
    Mu50:
    SAV1164
    MW2:
    MW1046
    RF122:
    SAB1029
    ST398:
    SAPIG1159
    T0131:
    SAT0131_01208 (rplR)
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_1101
    VC40:
    SAVC_04975

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---------MTELNNIINSLQSLFESESGYKISKNSGVPYQTVQDLRNGKTKLEDARFRT
    N315            ---------MTELNNIINSLQSLFESESGYKISKNSGVPYQTVQDLRNGKTKLEDARFRT
    NCTC8325        MLIQERGLKMTELNNIINSLQSLFESESGYKISKNSGVPYQTVQDLRNGKTKLEDARFRT
    Newman          ---------MTELNNIINSLQSLFESESGYKISKNSGVPYQTVQDLRNGKTKLEDARFRT
                             ***************************************************

    COL             IIKLYSYYVSLKEH
    N315            IIKLYSYYVSLKEH
    NCTC8325        IIKLYSYYVSLKEH
    Newman          IIKLYSYYVSLKEH
                    **************