From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01315
  • pan locus tag?: SAUPAN003692000
  • symbol: SAOUHSC_01315
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01315
  • symbol: SAOUHSC_01315
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1259029..1259217
  • length: 189
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGAACATTTCAAATGAAAATACAGTCACATTAATTGCAGTAATTATCGCAATTATCATT
    GGTATTTTCCTACAAATATTTTTCAAATTACCATTAATAGTGACGGCAGTACTATCTATT
    TTATTGGGTATCTTTGTAGGCTTTATCGTTTACTTGATTGTTTCGTTTTATAATAAGCGA
    AAAAATTAG
    60
    120
    180
    189

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01315
  • symbol: SAOUHSC_01315
  • description: hypothetical protein
  • length: 62
  • theoretical pI: 10.3273
  • theoretical MW: 6956.53
  • GRAVY: 1.55323

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsMFS transporter, sugar porter (SP) family (TIGR00879; HMM-score: 12.5)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsbile acid transporter (TIGR00841; HMM-score: 11.5)
    cxxc_20_cxxc protein (TIGR04104; HMM-score: 8.3)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype VII secretion protein EssA (TIGR03927; HMM-score: 7.5)
    chain length determinant protein EpsF (TIGR03017; HMM-score: 6.8)
    cobalt transporter subunit CbtB (proposed) (TIGR02459; HMM-score: 6.2)
  • TheSEED:  
    FIG01108130: hypothetical protein 
  • PFAM:
    MviN_MATE (CL0222) Polysacc_synt_C; Polysaccharide biosynthesis C-terminal domain (PF14667; HMM-score: 17.6)
    no clan definedDUF4396; Domain of unknown function (DUF4396) (PF14342; HMM-score: 17.3)
    Apoptosis-Inhib (CL0453) Bax1-I; Inhibitor of apoptosis-promoting Bax1 (PF01027; HMM-score: 16.1)
    no clan definedDUF2613; Protein of unknown function (DUF2613) (PF11021; HMM-score: 14.7)
    RseC_MucC; Positive regulator of sigma(E), RseC/MucC (PF04246; HMM-score: 12.2)
    DUF4191; Domain of unknown function (DUF4191) (PF13829; HMM-score: 11.9)
    DUF2583; Protein of unknown function (DUF2583) (PF10762; HMM-score: 11.6)
    O-anti_assembly (CL0499) Wzy_C; O-Antigen ligase (PF04932; HMM-score: 11.5)
    Peptidase_AD (CL0130) Peptidase_A24; Type IV leader peptidase family (PF01478; HMM-score: 11.5)
    no clan definedMyc_target_1; Myc target protein 1 (PF15179; HMM-score: 10.8)
    Yip1 (CL0112) DUF1129; Protein of unknown function (DUF1129) (PF06570; HMM-score: 10.3)
    no clan definedDUF973; Protein of unknown function (DUF973) (PF06157; HMM-score: 10.1)
    DUF4407; Domain of unknown function (DUF4407) (PF14362; HMM-score: 9.9)
    ABC-2 (CL0181) ABC2_membrane_3; ABC-2 family transporter protein (PF12698; HMM-score: 8.6)
    no clan definedDUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 8.4)
    Ninjurin; Ninjurin (PF04923; HMM-score: 8)
    Phage_holin_6_1; Bacteriophage holin of superfamily 6 (Holin_LLH) (PF09682; HMM-score: 7.5)
    IT (CL0182) CitMHS; Citrate transporter (PF03600; HMM-score: 7.3)
    no clan definedLapA_dom; Lipopolysaccharide assembly protein A domain (PF06305; HMM-score: 7.1)
    Halogen_Hydrol; 5-bromo-4-chloroindolyl phosphate hydrolysis protein (PF10112; HMM-score: 7)
    DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 6.6)
    Tetraspannin (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 6.5)
    no clan definedIncA; IncA protein (PF04156; HMM-score: 6.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.104
    • Ymax_pos: 11
    • Cmax: 0.124
    • Cmax_pos: 30
    • Smax: 0.135
    • Smax_pos: 1
    • Smean: 0.105
    • D: 0.104
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNISNENTVTLIAVIIAIIIGIFLQIFFKLPLIVTAVLSILLGIFVGFIVYLIVSFYNKRKN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAOUHSC_01315 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]