From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003692000
  • symbol?:
  • description?: membrane protein
  • strand?: -
  • coordinates?: 3998518..3998706
  • synteny block?: BlockID0027580
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1278
    08BA02176:
    C248_1357
    11819-97:
    MS7_1282
    71193:
    ST398NM01_1325
    ECT-R 2:
    ECTR2_1182
    ED133:
    SAOV_1336c
    ED98:
    SAAV_1302
    HO 5096 0412:
    SAEMRSA15_11700
    JH1:
    SaurJH1_1411
    JH9:
    SaurJH9_1384
    JKD6008:
    SAA6008_01287
    JKD6159:
    SAA6159_01190
    LGA251:
    SARLGA251_12320
    M013:
    M013TW_1271
    MRSA252:
    SAR1333
    MSHR1132:
    SAMSHR1132_11680
    MSSA476:
    SAS1263
    Mu3:
    SAHV_1312
    Mu50:
    SAV1323
    MW2:
    MW1210
    RF122:
    SAB1181c
    ST398:
    SAPIG1325
    T0131:
    SAT0131_01392 (ssb)
    TCH60:
    HMPREF0772_11885
    TW20:
    SATW20_13250
    USA300_TCH1516:
    USA300HOU_1267
    VC40:
    SAVC_05855

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MNISNENTVTLIAVIIAIIIGIFLQIFFKLPLIVTAVLSILLGIFVGFIVYLIVSFYNKR
    NCTC8325        MNISNENTVTLIAVIIAIIIGIFLQIFFKLPLIVTAVLSILLGIFVGFIVYLIVSFYNKR
    Newman          MNISNENTVTLIAVIIAIIIGIFLQIFFKLPLIVTAVLSILLGIFVGFIVYLIVSFYNKR
    USA300_FPR3757  MNISNENTVTLIAVIIAIIIGIFLQIFFKLPLIVTAVLSILLGIFVGFIVYLIVSFYNKR
                    ************************************************************

    N315            KN
    NCTC8325        KN
    Newman          KN
    USA300_FPR3757  KN
                    **