From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01336
  • pan locus tag?: SAUPAN003716000
  • symbol: SAOUHSC_01336
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01336
  • symbol: SAOUHSC_01336
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1276193..1276432
  • length: 240
  • essential: no [1] DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    TTGAGTAATTCTGATTTGAATATCGAAAGAATTAACGAGTTAGCTAAAAAGAAAAAAGAA
    GTAGGATTAACTCAAGAAGAAGCAAAGGAGCAAACAGCCTTAAGAAAAGCTTATCTTGAG
    AGTTTTAGAAAAGGGTTTAAACAACAAATTGAAAATACTAAAGTAATTGATCCAGAAGGT
    AATGATGTAACACCTGAAAAAATTAAAGAGATACAACAAAAAAGAGATAATAAAAATTAA
    60
    120
    180
    240

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01336
  • symbol: SAOUHSC_01336
  • description: hypothetical protein
  • length: 79
  • theoretical pI: 9.63152
  • theoretical MW: 9203.33
  • GRAVY: -1.32025

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA (cytosine-5-)-methyltransferase (TIGR00675; EC 2.1.1.37; HMM-score: 14.4)
  • TheSEED:  
    FIG01108406: hypothetical protein 
  • PFAM:
    no clan definedDUF896; Bacterial protein of unknown function (DUF896) (PF05979; HMM-score: 109.1)
    DUF3653; Phage protein (PF12375; HMM-score: 12.8)
    DUF5322; Family of unknown function (DUF5322) (PF17255; HMM-score: 11.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.132
    • Ymax_pos: 16
    • Cmax: 0.12
    • Cmax_pos: 29
    • Smax: 0.251
    • Smax_pos: 7
    • Smean: 0.169
    • D: 0.147
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSNSDLNIERINELAKKKKEVGLTQEEAKEQTALRKAYLESFRKGFKQQIENTKVIDPEGNDVTPEKIKEIQQKRDNKN

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]