From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003716000
  • symbol?:
  • description?: protein Stu0508
  • strand?: +
  • coordinates?: 4017753..4017993
  • synteny block?: BlockID0027820
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1296
    08BA02176:
    C248_1377
    11819-97:
    MS7_1300
    71193:
    ST398NM01_1343
    ECT-R 2:
    ECTR2_1200
    ED133:
    SAOV_1354
    ED98:
    SAAV_1322
    HO 5096 0412:
    SAEMRSA15_11880
    JH1:
    SaurJH1_1429
    JH9:
    SaurJH9_1402
    JKD6008:
    SAA6008_01307
    JKD6159:
    SAA6159_01208
    LGA251:
    SARLGA251_12500
    M013:
    M013TW_1289
    MRSA252:
    SAR1351
    MSHR1132:
    SAMSHR1132_11860
    MSSA476:
    SAS1281
    Mu3:
    SAHV_1330
    Mu50:
    SAV1341
    MW2:
    MW1228
    RF122:
    SAB1199
    ST398:
    SAPIG1343
    T0131:
    SAT0131_01412
    TCH60:
    HMPREF0772_11867
    TW20:
    SATW20_13430
    USA300_TCH1516:
    VC40:
    SAVC_05945

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSNSDLNIERINELAKKKKEVGLTQEEAKEQTALRKAYLESFRKGFKQQIENTKVIDPEG
    N315            MSNSDLNIERINELAKKKKEVGLTQEEAKEQTALRKAYLESFRKGFKQQIENTKVIDPEG
    NCTC8325        MSNSDLNIERINELAKKKKEVGLTQEEAKEQTALRKAYLESFRKGFKQQIENTKVIDPEG
    Newman          MSNSDLNIERINELAKKKKEVGLTQEEAKEQTALRKAYLESFRKGFKQQIENTKVIDPEG
    USA300_FPR3757  MSNSDLNIERINELAKKKKEVGLTQEEAKEQTALRKAYLESFRKGFKQQIENTKVIDPEG
                    ************************************************************

    COL             NDVTPEKIKEIQQKRDNKN
    N315            NDVTPEKIKEIQQKRDNKN
    NCTC8325        NDVTPEKIKEIQQKRDNKN
    Newman          NDVTPEKIKEIQQKRDNKN
    USA300_FPR3757  NDVTPEKIKEIQQKRDNKN
                    *******************