From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01340
  • pan locus tag?: SAUPAN003720000
  • symbol: SAOUHSC_01340
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01340
  • symbol: SAOUHSC_01340
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1279279..1279707
  • length: 429
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGGGAACTATAGTTATAGTTATTCGTATGAAAGCTCAAAATTATCCGGTAAATGAGAAA
    AAAATAGTTTTGCCACCGTTTTTTATGGCGACCGGTGCATTGATGTACGTCGTTCCATAT
    TTTAGGCTAACAGGATCGGAAATGCTAGAAGCCTTTATAATTGGTTTGCTTTTTTCTACA
    GTTCTAATTTGGACTTCTCGATTTGAAGTCAAAGGTACAGAAATTTATATGAAACGATCT
    AAAGCATTTCCAGTTATTTTGATTTCATTACTTATCATTCGTACTGTGATGAAAATATTC
    ATTAGTAATGAAATAGATCCTGGAGAATTAGGCGGCATGTTCTTTTTATTAGCATTCTGT
    ATGATTGTTCCTTGGAGAGCAGCAATGCTATATAAATACAAAAAACTAAAGAAAACATTA
    ATCAATTAA
    60
    120
    180
    240
    300
    360
    420
    429

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01340
  • symbol: SAOUHSC_01340
  • description: hypothetical protein
  • length: 142
  • theoretical pI: 10.4632
  • theoretical MW: 16343
  • GRAVY: 0.679577

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCations and iron carrying compoundsmulticomponent Na+:H+ antiporter (TIGR00942; HMM-score: 14.4)
  • TheSEED:  
    Uncharacterized membrane protein CcdC 
  • PFAM:
    no clan definedDUF1453; Protein of unknown function (DUF1453) (PF07301; HMM-score: 188.8)
    DUF4396; Domain of unknown function (DUF4396) (PF14342; HMM-score: 10.5)
    DUF4181; Domain of unknown function (DUF4181) (PF13789; HMM-score: 9.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.147
    • Ymax_pos: 22
    • Cmax: 0.122
    • Cmax_pos: 22
    • Smax: 0.242
    • Smax_pos: 12
    • Smean: 0.151
    • D: 0.149
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MGTIVIVIRMKAQNYPVNEKKIVLPPFFMATGALMYVVPYFRLTGSEMLEAFIIGLLFSTVLIWTSRFEVKGTEIYMKRSKAFPVILISLLIIRTVMKIFISNEIDPGELGGMFFLLAFCMIVPWRAAMLYKYKKLKKTLIN

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]