From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003720000
  • symbol?:
  • description?: Membrane protein involved in cytochrome C biogenesis

      descriptions from strain specific annotations:

    • Membrane protein involved in cytochrome C biogenesis
    • CcdC protein
    • membrane protein
    • membrane protein CcdC involved in cytochrome C biogenesis
  • strand?: +
  • coordinates?: 4020878..4021345
  • synteny block?: BlockID0027860
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1299
    08BA02176:
    C248_1380
    11819-97:
    MS7_1303
    71193:
    ST398NM01_1346
    ECT-R 2:
    ECTR2_1203
    ED133:
    SAOV_1357
    ED98:
    SAAV_1325
    HO 5096 0412:
    SAEMRSA15_11910
    JH1:
    SaurJH1_1433
    JH9:
    SaurJH9_1406
    JKD6008:
    SAA6008_01310 (ccdC)
    JKD6159:
    SAA6159_01211 (ccdC)
    LGA251:
    SARLGA251_12530
    M013:
    M013TW_1292
    MRSA252:
    SAR1355
    MSHR1132:
    SAMSHR1132_11890
    MSSA476:
    SAS1284
    Mu3:
    SAHV_1333
    Mu50:
    SAV1344
    MW2:
    MW1231
    RF122:
    SAB1202
    ST398:
    SAPIG1346
    T0131:
    SAT0131_01415 (nasE)
    TCH60:
    HMPREF0772_11864
    TW20:
    SATW20_13460
    USA300_TCH1516:
    VC40:
    SAVC_05960

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLYLIFSIIVALFMGTIVIVIRMKAQNYPVNEKKIVLPPFFMATGALMYVVPYFRLTGSE
    N315            MLYLIFSIIVALFMGTIVIVIRMKAQNYPVNEKKIVLPPFFMATGALMYVVPYFRLTGSE
    NCTC8325        -------------MGTIVIVIRMKAQNYPVNEKKIVLPPFFMATGALMYVVPYFRLTGSE
    Newman          MLYLIFSIIVALFMGTIVIVIRMKAQNYPVNEKKIVLPPFFMATGALMYVVPYFRLTGSE
    USA300_FPR3757  -------------MGTIVIVIRMKAQNYPVNEKKIVLPPFFMATGALMYVVPYFRLTGSE
                                 ***********************************************

    COL             MLEAFIIGLLFSTVLIWTSRFEVKGTEIYMKRSKAFPVILISLLIIRTVMKIFISNEIDP
    N315            MLEAFIIGLLFSTVLIWTSRFEVKGTEIYMKRSKAFPVILISLLIIRTVMKIFISNEIDP
    NCTC8325        MLEAFIIGLLFSTVLIWTSRFEVKGTEIYMKRSKAFPVILISLLIIRTVMKIFISNEIDP
    Newman          MLEAFIVGLLFSTDLIWTSRFEVKGTEIYMERSIAFPVILISLLIIRTVMKIFISNEIDP
    USA300_FPR3757  MLEAFIIGLLFSTVLIWTSRFEVKGTEIYMKRSKAFPVILISLLIIRTVMKIFISNEIDP
                    ******:****** ****************:** **************************

    COL             GELGGMFFLLAFCMIVPWRAAMLYKYKKLKKTLIN
    N315            GELGGMFFLLAFCMIVPWRAAMLYKYKKLKKTLIN
    NCTC8325        GELGGMFFLLAFCMIVPWRAAMLYKYKKLKKTLIN
    Newman          GELGGMFFLLAFCMIVPWRAAMLYKYKKLKKTLIN
    USA300_FPR3757  GELGGMFFLLAFCMIVPWRAAMLYKYKKLKKTLIN
                    ***********************************