From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01377
  • pan locus tag?: SAUPAN003784000
  • symbol: SAOUHSC_01377
  • pan gene symbol?: opp-2F
  • synonym:
  • product: oligopeptide ABC transporter ATP-binding protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01377
  • symbol: SAOUHSC_01377
  • product: oligopeptide ABC transporter ATP-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1321711..1322412
  • length: 702
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGATTGAGTTAAAACATGTGACTTTTGGTTATAATAAAAAGCAGATGGTGCTACAAGAT
    ATCAATATTACTATACCTGATGGAGAAAATGTTGGTATTTTAGGCGAAAGTGGCTGTGGT
    AAAAGTACGCTCGCTTCATTGGTTCTTGGCTTGTTTAAACCTGTTAAAGGAGAGATTTAC
    TTAAGTGACAATGCTGTGTTACCGATTTTCCAACACCCTTTAACTAGCTTTAACCCTGAT
    TGGACGATTGAGACCTCATTAAAAGAAGCGTTATATTATTACAGAGGTCTAACTGATAAT
    ACTGCTCAGGATCAATTATTATTACAACATTTATCTACTTTTGAGTTAAACGCGCAATTA
    TTGACTAAATTACCAAGCGAAGTGAGTGGCGGACAATTACAAAGATTTAATGTCATGCGT
    TCGTTATTAGCACAGCCTCGCGTTTTAATATGTGATGAGATAACTTCAAATTTAGATGTT
    ATAGCTGAACAAAATGTAATCAATATATTAAAAGCGCAAACGATTACGAACTTAAATCAT
    TTTATCGTTATTTCTCATGATTTATCCGTGTTACAACGCTTAGTTAATAGAATTATCGTT
    CTTAAGGATGGCATGATAGTCGATGATTTTGCAATAGAGGAATTATTTAATGTTGATAGA
    CACCCTTATACAAAAGAATTAGTGCAAGCATTTTCATATTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    702

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01377
  • symbol: SAOUHSC_01377
  • description: oligopeptide ABC transporter ATP-binding protein
  • length: 233
  • theoretical pI: 5.04971
  • theoretical MW: 26257.1
  • GRAVY: 0.0802575

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCations and iron carrying compoundsnickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 168.7)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsnickel import ATP-binding protein NikD (TIGR02770; HMM-score: 134.8)
    Cellular processesCellular processesBiosynthesis of natural productsNHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 124.5)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesNHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 124.5)
    Cellular processesCellular processesPathogenesistype I secretion system ATPase (TIGR03375; HMM-score: 116)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion system ATPase (TIGR03375; HMM-score: 116)
    MetabolismTransport and binding proteinsUnknown substrateenergy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 115.6)
    Cellular processesCellular processesBiosynthesis of natural productsNHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 113.5)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesNHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 113.5)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion system ATPase (TIGR01846; HMM-score: 113.1)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingABC-type bacteriocin transporter (TIGR01193; HMM-score: 106.2)
    Genetic information processingProtein fateProtein modification and repairABC-type bacteriocin transporter (TIGR01193; HMM-score: 106.2)
    MetabolismTransport and binding proteinsOtherABC-type bacteriocin transporter (TIGR01193; HMM-score: 106.2)
    MetabolismTransport and binding proteinsAnionsphosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 104.4)
    MetabolismTransport and binding proteinsUnknown substrateenergy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 104.3)
    Cellular processesCellular processesCell divisioncell division ATP-binding protein FtsE (TIGR02673; HMM-score: 99.1)
    Genetic information processingProtein fateProtein and peptide secretion and traffickinglipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 97.2)
    D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 95.2)
    MetabolismTransport and binding proteinsOtherantigen peptide transporter 2 (TIGR00958; HMM-score: 94.8)
    MetabolismTransport and binding proteinsAnionsmolybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 94.1)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 93.6)
    ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 93.1)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 92.9)
    MetabolismTransport and binding proteinsOtherthiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 92.7)
    Cellular processesCellular processesToxin production and resistanceputative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 91.8)
    MetabolismTransport and binding proteinsUnknown substrateputative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 91.8)
    proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 90.7)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharideslipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 90.3)
    MetabolismTransport and binding proteinsOtherlipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 90.3)
    ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 88.9)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion system ATPase (TIGR01842; HMM-score: 86.7)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesglycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 85.5)
    MetabolismTransport and binding proteinsAnionsphosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 84.9)
    ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 79.9)
    MetabolismTransport and binding proteinsAnionsnitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 79.7)
    MetabolismTransport and binding proteinsOthernitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 79.7)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 79.7)
    MetabolismEnergy metabolismMethanogenesismethyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 78.7)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesputative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 78.4)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 76)
    MetabolismTransport and binding proteinsAnionssulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 74.8)
    MetabolismTransport and binding proteinsOtherdaunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 70.2)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherFeS assembly ATPase SufC (TIGR01978; HMM-score: 69.5)
    lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 69.2)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesLPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 67.3)
    MetabolismTransport and binding proteinsOtherLPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 67.3)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesurea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 66.9)
    MetabolismCentral intermediary metabolismPhosphorus compoundsphosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 66.6)
    MetabolismTransport and binding proteinsCations and iron carrying compoundscobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 65.6)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsglucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 64.7)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 64.7)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminespolyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 63.8)
    Cellular processesCellular processesOthernodulation ABC transporter NodI (TIGR01288; HMM-score: 62.8)
    MetabolismTransport and binding proteinsOthernodulation ABC transporter NodI (TIGR01288; HMM-score: 62.8)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 62.1)
    gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 61.6)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsD-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 59.9)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingheme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 59.6)
    MetabolismTransport and binding proteinsOtherheme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 59.6)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminescyclic peptide transporter (TIGR01194; HMM-score: 58.6)
    MetabolismTransport and binding proteinsOthercyclic peptide transporter (TIGR01194; HMM-score: 58.6)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesurea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 58.6)
    MetabolismTransport and binding proteinsUnknown substrateanchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 57.3)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminescholine ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 56.5)
    MetabolismTransport and binding proteinsOthermulti drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 51.4)
    MetabolismTransport and binding proteinsOtherpigment precursor permease (TIGR00955; HMM-score: 50.3)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsperoxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 46.1)
    MetabolismTransport and binding proteinsAnionscystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 39.2)
    MetabolismTransport and binding proteinsOtherpleiotropic drug resistance family protein (TIGR00956; HMM-score: 24.3)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairexcinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 23.5)
    MetabolismTransport and binding proteinsOtherrim ABC transporter (TIGR01257; HMM-score: 18.6)
    Cellular processesCellular processesPathogenesistype III secretion apparatus H+-transporting two-sector ATPase (TIGR02546; EC 3.6.3.14; HMM-score: 14.6)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype III secretion apparatus H+-transporting two-sector ATPase (TIGR02546; EC 3.6.3.14; HMM-score: 14.6)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesoligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain (TIGR01727; HMM-score: 14.5)
    Cellular processesCellular processesChemotaxis and motilityflagellar protein export ATPase FliI (TIGR03497; EC 3.6.3.14; HMM-score: 11.8)
    Cellular processesCellular processesChemotaxis and motilityflagellar protein export ATPase FliI (TIGR03496; EC 3.6.3.14; HMM-score: 11.1)
  • TheSEED:  
    ABC-type dipeptide/oligopeptide/nickel transport system, ATP-binding protein 
  • PFAM:
    P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 81.4)
    SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 19.4)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 19.4)
    AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 17.3)
    AAA_22; AAA domain (PF13401; HMM-score: 16.1)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 14.9)
    IstB_IS21; IstB-like ATP binding protein (PF01695; HMM-score: 14.3)
    AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 14)
    Sigma54_activat; Sigma-54 interaction domain (PF00158; HMM-score: 13.9)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 13.6)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 13.2)
    no clan definedoligo_HPY; Oligopeptide/dipeptide transporter, C-terminal region (PF08352; HMM-score: 13.2)
    P-loop_NTPase (CL0023) RNA_helicase; RNA helicase (PF00910; HMM-score: 12.7)
    Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 12.3)
    PRK; Phosphoribulokinase / Uridine kinase family (PF00485; HMM-score: 12.1)
    ATP-synt_ab; ATP synthase alpha/beta family, nucleotide-binding domain (PF00006; HMM-score: 11.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.01
    • Cytoplasmic Membrane Score: 9.99
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 0.67
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.118
    • Ymax_pos: 58
    • Cmax: 0.121
    • Cmax_pos: 58
    • Smax: 0.158
    • Smax_pos: 57
    • Smean: 0.099
    • D: 0.111
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIELKHVTFGYNKKQMVLQDINITIPDGENVGILGESGCGKSTLASLVLGLFKPVKGEIYLSDNAVLPIFQHPLTSFNPDWTIETSLKEALYYYRGLTDNTAQDQLLLQHLSTFELNAQLLTKLPSEVSGGQLQRFNVMRSLLAQPRVLICDEITSNLDVIAEQNVINILKAQTITNLNHFIVISHDLSVLQRLVNRIIVLKDGMIVDDFAIEELFNVDRHPYTKELVQAFSY

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-3661
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]

Aurelia Hiron, Brunella Posteraro, Marie Carrière, Laetitia Remy, Cécile Delporte, Marilena La Sorda, Maurizio Sanguinetti, Vincent Juillard, Elise Borezée-Durant
A nickel ABC-transporter of Staphylococcus aureus is involved in urinary tract infection.
Mol. Microbiol.: 2010, 77(5);1246-60
[PubMed:20662775] [WorldCat.org] [DOI] (I p)
S N Coulter, W R Schwan, E Y Ng, M H Langhorne, H D Ritchie, S Westbrock-Wadman, W O Hufnagle, K R Folger, A S Bayer, C K Stover
Staphylococcus aureus genetic loci impacting growth and survival in multiple infection environments.
Mol. Microbiol.: 1998, 30(2);393-404
[PubMed:9791183] [WorldCat.org] (P p)