From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003784000
  • symbol?: opp-2F
  • description?: ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • ABC transporter ATP-binding protein
    • oligopeptide ABC transporter ATP-binding protein
    • peptide ABC transporter ATP-binding protein
    • oligopeptide transporter ATPase
    • oligopeptide permease, ATP-binding protein
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • ABC transporter family protein
    • ABC-type dipeptide/oligopeptide/nickel transporter, ATPase component 2
    • ABC-type dipeptide/oligopeptide/nickel transport system, ATP-binding protein
    • dipeptide/oligopeptide/nickel ABC transporter ATP-binding protein
    • oligopeptide transporter ATPase subunit
    • Opp-2F
    • putative oligopeptide transporter ATPase
  • strand?: -
  • coordinates?: 4078045..4078781
  • synteny block?: BlockID0028410
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1211 (opp-2F)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    SAUSA300_1273 (opp-2F)
    04-02981:
    SA2981_1333 (opp-2F)
    08BA02176:
    C248_1416
    11819-97:
    MS7_1336
    71193:
    ST398NM01_1379
    ECT-R 2:
    ECTR2_1236
    ED133:
    SAOV_1388c
    ED98:
    SAAV_1361
    HO 5096 0412:
    SAEMRSA15_12430
    JH1:
    SaurJH1_1469
    JH9:
    SaurJH9_1440
    JKD6008:
    SAA6008_01343 (nikE)
    JKD6159:
    SAA6159_01246 (nikE)
    LGA251:
    SARLGA251_12960
    M013:
    M013TW_1324
    MRSA252:
    SAR1392
    MSHR1132:
    SAMSHR1132_12210
    MSSA476:
    SAS1320
    Mu3:
    SAHV_1367
    Mu50:
    SAV1379
    MW2:
    MW1267 (opp-2F)
    RF122:
    SAB1234c
    ST398:
    SAPIG1379
    T0131:
    SAT0131_01450
    TCH60:
    HMPREF0772_11829
    TW20:
    SATW20_13780
    USA300_TCH1516:
    USA300HOU_1313
    VC40:
    SAVC_06140

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIELKHVTFGYNKKQMVLQDINITIPDGENVGILGESGCGKSTLASLVLGLFKPVKGEIY
    N315            MIELKHVTFGYNKKQMVLQDINITIPDGENVGILGESGCGKSTLASLVLGLFKPVKGEIY
    NCTC8325        MIELKHVTFGYNKKQMVLQDINITIPDGENVGILGESGCGKSTLASLVLGLFKPVKGEIY
    Newman          MIELKHVTFGYNKKQMVLQDINITIPDGENVGILGESGCGKSTLASLVLGLFKPVKGEIY
    USA300_FPR3757  MIELKHVTFGYNKKQMVLQDINITIPDGENVGILGESGCGKSTLASLVLGLFKPVKGEIY
                    ************************************************************

    COL             LSDNAVLPIFQHPLTSFNPDWTIETSLKEALYYYRGLTDNTAQDQLLLQHLSTFELNAQL
    N315            LSDNAVLTIFQHPLTSFNPDWTIETSLKEALYYYRGLTDNTAQDQLLLQHLSTFELNAQL
    NCTC8325        LSDNAVLPIFQHPLTSFNPDWTIETSLKEALYYYRGLTDNTAQDQLLLQHLSTFELNAQL
    Newman          LSDNAVLPIFQHPLTSFNPDWTIETSLKEALYYYRGLTDNTAQDQLLLQHLSTFELNAQL
    USA300_FPR3757  LSDNAVLPIFQHPLTSFNPDWTIETSLKEALYYYRGLTDNTAQDQLLLQHLSTFELNAQL
                    *******.****************************************************

    COL             LTKLPSEVSGGQLQRFNVMRSLLAQPRVLICDEITSNLDVIAEQNVINILKAQTITNLNH
    N315            LTKLPSEVSGGQLQRFNVMRSLLAQPRVLICDEITSNLDVIAEQNVINILKAQTITNLNH
    NCTC8325        LTKLPSEVSGGQLQRFNVMRSLLAQPRVLICDEITSNLDVIAEQNVINILKAQTITNLNH
    Newman          LTKLPSEVSGGQLQRFNVMRSLLAQPRVLICDEITSNLDVIAEQNVINILKAQTITNLNH
    USA300_FPR3757  LTKLPSEVSGGQLQRFNVMRSLLAQPRVLICDEITSNLDVIAEQNVINILKAQTITNLNH
                    ************************************************************

    COL             FIVISHDLSVLQRLVNRIIVLKDGMIVDDFAIEELFNVDRHPYTKELVQAFSY
    N315            FIVISHDLSVLQRLVNRIIVLKDGMIVDDFAIEELFNVDRHPYTKELVQTFSY
    NCTC8325        FIVISHDLSVLQRLVNRIIVLKDGMIVDDFAIEELFNVDRHPYTKELVQAFSY
    Newman          FIVISHDLSVLQRLVNRIIVLKDGMIVDDFAIEELFNVDRHPYTKELVQAFSY
    USA300_FPR3757  FIVISHDLSVLQRLVNRIIVLKDGMIVDDFAIEELFNVDRHPYTKELVQAFSY
                    *************************************************:***