From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01593
  • pan locus tag?: SAUPAN004032000
  • symbol: SAOUHSC_01593
  • pan gene symbol?: nudF
  • synonym:
  • product: NUDIX domain-containing protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01593
  • symbol: SAOUHSC_01593
  • product: NUDIX domain-containing protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1518486..1519028
  • length: 543
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGGATTTAAATGAAAAAACAATTGATCGAACAGTTATTTATAATGGCAAAATTGTAGAT
    GTAGAAATTCATACAGTGACATTACCAAACGGTGAAACGTCAACAAGAGAATTAGTTTAT
    CATAATGGTGCAGTTGCTGTTTGTGCAGTGACACCTAAAAAAGAAGTCGTATTAGTGAAA
    CAGTATCGTAAACCAGTAGAAAAACCATTGCTAGAAATTCCAGCTGGTAAATTAGAAGAT
    GATGAAGATAGAGTCGAAGCGGCAAAACGTGAATTAGAAGAAGAAACAGGATATATTGCC
    AAAGAGTTAACACATGTTGTAGATATGTATGGTTCACCAGGTTTTTGCGATGAACAATTA
    TCAATATATTTTACGGATAATTTAGAAGAAGGTACAGTTCACTTAGATGAAGATGAATTT
    GTCGAAGTCATTAAAGTTCCGATTGAGAATGTTAAATCGATGCTAATGAATAAAGAAATA
    GAAGATGCGAAGACTATCATTGCATTGCAACACCTATTATTAAATTATAATCATTCTAAA
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    543

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01593
  • symbol: SAOUHSC_01593
  • description: NUDIX domain-containing protein
  • length: 180
  • theoretical pI: 4.45704
  • theoretical MW: 20439.1
  • GRAVY: -0.357222

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Unknown functionEnzymes of unknown specificitynudix-type nucleoside diphosphatase, YffH/AdpP family (TIGR00052; EC 3.6.1.-; HMM-score: 69.9)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairnucleoside triphosphatase YtkD (TIGR02705; EC 3.6.1.-; HMM-score: 31.6)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairmutator mutT protein (TIGR00586; EC 3.6.1.-; HMM-score: 20.7)
  • TheSEED:  
    Cofactors, Vitamins, Prosthetic Groups, PigmentsNAD and NADPNAD and NADP cofactor biosynthesis global ADP-ribose pyrophosphatase (EC 3.6.1.13) 
    Nucleosides and NucleotidesDetoxificationNudix proteins (nucleoside triphosphate hydrolases) ADP-ribose pyrophosphatase (EC 3.6.1.13) 
  • PFAM:
    NUDIX (CL0261) NUDIX; NUDIX domain (PF00293; HMM-score: 66.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.11
    • Ymax_pos: 47
    • Cmax: 0.12
    • Cmax_pos: 50
    • Smax: 0.149
    • Smax_pos: 41
    • Smean: 0.098
    • D: 0.105
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MDLNEKTIDRTVIYNGKIVDVEIHTVTLPNGETSTRELVYHNGAVAVCAVTPKKEVVLVKQYRKPVEKPLLEIPAGKLEDDEDRVEAAKRELEEETGYIAKELTHVVDMYGSPGFCDEQLSIYFTDNLEEGTVHLDEDEFVEVIKVPIENVKSMLMNKEIEDAKTIIALQHLLLNYNHSK

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]