From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004032000
  • symbol?: nudF
  • description?: ADP-ribose pyrophosphatase

      descriptions from strain specific annotations:

    • ADP-ribose pyrophosphatase
    • NUDIX hydrolase
    • MutT/nudix family protein
    • NUDIX domain-containing protein
    • ADP-ribose diphosphatase
    • putative ADP-ribose pyrophosphatase
    • ADP-ribose pyrophosphatase, NudF
    • adp-ribose pyrophosphatase (adp-ribose diphosphatase)(adenosine diphosphoribose pyrophosphatase) (adpr-ppase) (adp-ribosephosphohydrolase) (asppase)
  • strand?: -
  • coordinates?: 4321457..4321999
  • synteny block?: BlockID0030690
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1456
    08BA02176:
    C248_1539
    11819-97:
    MS7_1516 (nudF)
    71193:
    ST398NM01_1565
    ECT-R 2:
    ECTR2_1350
    ED133:
    SAOV_1501
    ED98:
    SAAV_1489
    HO 5096 0412:
    SAEMRSA15_14210
    JH1:
    SaurJH1_1587
    JH9:
    SaurJH9_1556
    JKD6008:
    SAA6008_01469 (nudF)
    JKD6159:
    SAA6159_01428 (nudF)
    LGA251:
    SARLGA251_14070
    M013:
    M013TW_1513
    MRSA252:
    SAR1575
    MSHR1132:
    SAMSHR1132_13380
    MSSA476:
    SAS1439
    Mu3:
    SAHV_1487
    Mu50:
    SAV1499
    MW2:
    MW1453
    RF122:
    SAB1360c
    ST398:
    SAPIG1565
    T0131:
    SAT0131_01592
    TCH60:
    HMPREF0772_11642
    TW20:
    SATW20_14970
    USA300_TCH1516:
    USA300HOU_1500 (nudF)
    VC40:
    SAVC_06745

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDLNEKTIDRTVIYNGKIVDVEIHTVTLPNGETSTRELVYHNGAVAVCAVTPKKEVVLVK
    N315            MDLNEKTIDRTVIYNGKIVDVEIHTVTLPNGETSTRELVYHNGAVAVCALTPKKEVVLVK
    NCTC8325        MDLNEKTIDRTVIYNGKIVDVEIHTVTLPNGETSTRELVYHNGAVAVCAVTPKKEVVLVK
    Newman          MDLNEKTIDRTVIYNGKIVDVEIHTVTLPNGETSTRELVYHNGAVAVCAVTPKKEVVLVK
    USA300_FPR3757  MDLNEKTIDRTVIYNGKIVDVEIHTVTLPNGETSTRELVYHNGAVAVCAVTPKKEVVLVK
                    *************************************************:**********

    COL             QYRKPVEKPLLEIPAGKLEDDEDRVEAAKRELEEETGYIAKELTHVVDMYGSPGFCDEQL
    N315            QYRKPVEKPLLEIPAGKLEDDENRVEAAKRELEEETGYIAKELTHVVDMYGSPGFCDEQL
    NCTC8325        QYRKPVEKPLLEIPAGKLEDDEDRVEAAKRELEEETGYIAKELTHVVDMYGSPGFCDEQL
    Newman          QYRKPVEKPLLEIPAGKLEDDEDRVEAAKRELEEETGYIAKELTHVVDMYGSPGFCDEQL
    USA300_FPR3757  QYRKPVEKPLLEIPAGKLEDDEDRVEAAKRELEEETGYIAKELTHVVDMYGSPGFCDEQL
                    **********************:*************************************

    COL             SIYFTDNLEEGTVHLDEDEFVEVIKVPIENVKSMLMNKEIEDAKTIIALQHLLLNYNHSK
    N315            SIYFTDNLEEGTVHLDEDEFVEVIKVPIENVKSMLMNKEIEDAKTIIALQHLLLNYNHSK
    NCTC8325        SIYFTDNLEEGTVHLDEDEFVEVIKVPIENVKSMLMNKEIEDAKTIIALQHLLLNYNHSK
    Newman          SIYFTDNLEEGTVHLDEDEFVEVIKVPIENVKSMLMNKEIEDAKTIIALQHLLLNYNHSK
    USA300_FPR3757  SIYFTDNLEEGTVHLDEDEFVEVIKVPIENVKSMLMNKEIEDAKTIIALQHLLLNYNHSK
                    ************************************************************