From AureoWiki
Jump to: navigation, search

NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_03008
  • pan locus tag?: SAUPAN006428000
  • symbol: SAOUHSC_03008
  • pan gene symbol?: hisF
  • synonym:
  • product: multifunctional imidazole glycerol phosphate synthase subunit/phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_03008
  • symbol: SAOUHSC_03008
  • product: multifunctional imidazole glycerol phosphate synthase subunit/phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase
  • replicon: chromosome
  • strand: -
  • coordinates: 2782800..2783559
  • length: 759
  • essential: no DEG other strains
  • comment: The sequence of SAOUHSC_03008 was corrected based on the resequencing performed by Berscheid et al., 2012 [1], resulting in a shorter CDS.

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGATTAAAAAACGTATCATTCCATGTTTAGATGTCAAAGATGGTCGTGTCGTTAAAGGG
    ATTCAATTTAAAGGATTAAGGGATATTGGGAATCCTGTTGATTTAGCAATGTATTACAAT
    GAAGCGGGTGCTGATGAATTAGTATTTTTAGACATCTCTAAGACGGAAGAGGGTCATAGC
    TTAATGCTAGAAGTGATTGAACAGACAGCGTCACGCTTGTTTATCCCTCTTACTGTAGGG
    GGTGGGATTCAAAGTCTCGATGATATTACCCAATTGCTAAATCATGGTGCAGATAAAGTA
    TCATTAAATTCAAGTGCTTTAAAAAATCCACAGCTCATTAAACAAGCGAGTGATAAATTC
    GGTAGACAATGCATCTGCATAGCAATTGATAGCTATTATGATCCTGAAAGAAAAGCACAT
    TATTGTTGTACGACTGGTGGTAAAAAAATGACAAATATTAAAGTATATGACTGGGTACAG
    CAAGTAGAACAGTTAGGTGCAGGTGAGCTCCTCGTTACAAGTATGGGACATGATGGTATG
    AAACAAGGCTTTGATATTGAACACCTAGCAAATATTAAGTCTCTTGTAAATATTCCAATC
    ATTGCTTCTGGTGGTGGTGGCAATGCACAACACTTTGTAGAATTATTTGATCAGACGGAT
    GTTTCTGCAGGTTTAGCTGCAAGTATATTACATGATCGAGAAACGACGGTTCAATCTATT
    AAAGAAGTGATACGGCAAGGGGGTATAGCAGTAAGATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    759

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_03008
  • symbol: SAOUHSC_03008
  • description: multifunctional imidazole glycerol phosphate synthase subunit/phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase
  • length: 252
  • theoretical pI: 6.15747
  • theoretical MW: 27498.4
  • GRAVY: -0.097619

Function[edit source | edit]

  • reaction:
    EC 4.1.3.-?  ExPASy
    EC 3.6.1.31?  ExPASy
    Phosphoribosyl-ATP diphosphatase1-(5-phospho-beta-D-ribosyl)-ATP + H2O = 1-(5-phospho-beta-D-ribosyl)-AMP + diphosphate
    EC 3.5.4.19?  ExPASy
    Phosphoribosyl-AMP cyclohydrolase1-(5-phospho-beta-D-ribosyl)-AMP + H2O = 1-(5-phospho-beta-D-ribosyl)-5-((5-phospho-beta-D-ribosylamino)methylideneamino)imidazole-4-carboxamide
    5-[(5-phospho-1-deoxyribulos-1-ylamino)methylideneamino]-1-(5-phosphoribosyl)imidazole-4-carboxamide + L-glutamine = imidazole-glycerol phosphate + 5-aminoimidazol-4-carboxamide ribonucleotide + L-glutamate + H2O?
  • TIGRFAM:
    MetabolismAmino acid biosynthesisHistidine familyimidazoleglycerol phosphate synthase, cyclase subunit (TIGR00735; HMM-score: 334.3)
    glycosyl amidation-associated protein WbuZ (TIGR03572; HMM-score: 271.3)
    MetabolismAmino acid biosynthesisHistidine family1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase (TIGR00007; EC 5.3.1.16; HMM-score: 118.7)
    bifunctional HisA/TrpF protein (TIGR01919; EC 5.3.1.16,5.3.1.24; HMM-score: 74.2)
    Unknown functionGeneralhisA/hisF family protein (TIGR00734; HMM-score: 34.6)
    MetabolismAmino acid biosynthesisHistidine familyphosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (TIGR02129; EC 5.3.1.16; HMM-score: 33.2)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersThiaminethiamine-phosphate diphosphorylase (TIGR00693; EC 2.5.1.3; HMM-score: 24.3)
    Unknown functionGeneralputative TIM-barrel protein, nifR3 family (TIGR00737; HMM-score: 18.7)
    geranylgeranylglyceryl phosphate synthase family protein (TIGR01768; EC 2.5.1.-; HMM-score: 16.2)
    dihydroorotate dehydrogenase family protein (TIGR01037; EC 1.3.-.-; HMM-score: 14.3)
    MetabolismEnergy metabolismGlycolysis/gluconeogenesisfructose-1,6-bisphosphate aldolase, class II (TIGR01859; EC 4.1.2.13; HMM-score: 14.2)
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA dihydrouridine synthase A (TIGR00742; EC 1.-.-.-; HMM-score: 13.6)
    mycofactocin system FadH/OYE family oxidoreductase 2 (TIGR03997; EC 1.-.-.-; HMM-score: 12.9)
    phosphoglycerol geranylgeranyltransferase (TIGR01769; EC 2.5.1.41; HMM-score: 12.3)
  • TheSEED:  
    Histidine Biosynthesis in plants Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-) / Phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) / Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31) 
    Histidine Biosynthesis Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-) / Phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) / Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31) 
  • PFAM:
    TIM_barrel (CL0036) His_biosynth; Histidine biosynthesis protein (PF00977; HMM-score: 266.3)
    Dus; Dihydrouridine synthase (Dus) (PF01207; HMM-score: 29.3)
    TMP-TENI; Thiamine monophosphate synthase (PF02581; HMM-score: 26.6)
    NMO; Nitronate monooxygenase (PF03060; HMM-score: 21.7)
    G3P_antiterm; Glycerol-3-phosphate responsive antiterminator (PF04309; HMM-score: 20)
    PK_TIM (CL0151) PEP_mutase; Phosphoenolpyruvate phosphomutase (PF13714; HMM-score: 13.8)
    TIM_barrel (CL0036) ThiG; Thiazole biosynthesis protein ThiG (PF05690; HMM-score: 13)
    DHO_dh; Dihydroorotate dehydrogenase (PF01180; HMM-score: 12.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.135
    • Ymax_pos: 11
    • Cmax: 0.23
    • Cmax_pos: 45
    • Smax: 0.221
    • Smax_pos: 2
    • Smean: 0.183
    • D: 0.153
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIKKRIIPCLDVKDGRVVKGIQFKGLRDIGNPVDLAMYYNEAGADELVFLDISKTEEGHSLMLEVIEQTASRLFIPLTVGGGIQSLDDITQLLNHGADKVSLNSSALKNPQLIKQASDKFGRQCICIAIDSYYDPERKAHYCCTTGGKKMTNIKVYDWVQQVEQLGAGELLVTSMGHDGMKQGFDIEHLANIKSLVNIPIIASGGGGNAQHFVELFDQTDVSAGLAASILHDRETTVQSIKEVIRQGGIAVR

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Anne Berscheid, Peter Sass, Konstantin Weber-Lassalle, Ambrose L Cheung, Gabriele Bierbaum
    Revisiting the genomes of the Staphylococcus aureus strains NCTC 8325 and RN4220.
    Int. J. Med. Microbiol.: 2012, 302(2);84-7
    [PubMed:22417616] [WorldCat.org] [DOI] (I p)
  2. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]