From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006428000
  • symbol?: hisF
  • description?: imidazole glycerol phosphate synthase subunit HisF

      descriptions from strain specific annotations:

    • imidazole glycerol phosphate synthase subunit HisF
    • Imidazole glycerol phosphate synthase cyclase subunit
    • HisF cyclase-like protein
    • imidazole glycerol phosphate synthase, cyclase subunit
    • hisF protein (cyclase)
  • strand?: -
  • coordinates?: 6470709..6472097
  • synteny block?: BlockID0051350
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2697 (hisF)
    N315:
    SA2465 (hisF)
    NCTC8325:
    Newman:
    NWMN_2571 (hisF)
    USA300_FPR3757:
    04-02981:
    SA2981_2613 (hisF)
    08BA02176:
    C248_2742 (hisF)
    11819-97:
    MS7_2678 (hisF)
    71193:
    ST398NM01_2724
    ECT-R 2:
    ECTR2_2526 (hisF)
    ED133:
    SAOV_2724c
    ED98:
    SAAV_2746 (hisF)
    HO 5096 0412:
    SAEMRSA15_25790 (hisF)
    JH1:
    SaurJH1_2754
    JH9:
    SaurJH9_2697
    JKD6008:
    SAA6008_02732 (hisF)
    JKD6159:
    SAA6159_02570 (hisF)
    LGA251:
    SARLGA251_24460 (hisF)
    M013:
    M013TW_2656
    MRSA252:
    SAR2755 (hisF)
    MSHR1132:
    SAMSHR1132_25000
    MSSA476:
    SAS2558
    Mu3:
    SAHV_2657 (hisF)
    Mu50:
    SAV2673 (hisF)
    MW2:
    MW2592 (hisF)
    RF122:
    SAB2549c (hisF)
    ST398:
    SAPIG2724 (hisF)
    T0131:
    SAT0131_02952 (msrA)
    TCH60:
    HMPREF0772_10513 (hisF)
    TW20:
    SATW20_28100 (hisF)
    USA300_TCH1516:
    USA300HOU_2674 (hisF)
    VC40:
    SAVC_12240

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIKKRIIPCLDVKDGRVVKGIQFKGLRDIGNPVDLAMYYNEAGADELVFLDISKTEEGHS
    N315            MIKKRIIPCLDVKDGRVVKGIQFKGLRDIGNPVDLAIYYNEAGADELVFLDISKTEEGHS
    NCTC8325        MIKKRIIPCLDVKDGRVVKGIQFKGLRDIGNPVDLAMYYNEAGADELVFLDISKTEEGHS
    Newman          MIKKRIIPCLDVKDGRVVKGIQFKGLRDIGNPVDLAMYYNEAGADELVFLDISKTEEGHS
    USA300_FPR3757  MIKKRIIPCLDVKDGRVVKGIQFKGLRDIGNPVDLAMYYNEAGADELVFLDISKTEEGHS
                    ************************************:***********************

    COL             LMLEVIEQTASRLFIPLTVGGGIQSLDDITQLLNHGADKVSLNSSALKNPQLIKQASDKF
    N315            LMLEVIEQTASRLFIPLTVGGGIQSLDDITQLLNHGADKVSLNSSALKNPQLIKQASDKF
    NCTC8325        LMLEVIEQTASRLFIPLTVGGGIQSLDDITQLLNHGADKVSLNSSALKNPQLIKQASDKF
    Newman          LMLEVIEQTASRLFIPLTVGGGIQSLDDITQLLNHGADKVSLNSSALKNPQLIKQASDKF
    USA300_FPR3757  LMLEVIEQTASRLFIPLTVGGGIQSLDDITQLLNHGADKVSLNSSALKNPQLIKQASDKF
                    ************************************************************

    COL             GRQCICIAIDSYYDPERKAHYCCTTGGKKMTNIKVYDWVQQVEQLGAGELLVTSMGHDGM
    N315            GRQCICIAIDSYYDPERKAHYCCTHGGKKMTNIKVYDWVQQVEQLGAGELLVTSMGHDGM
    NCTC8325        GRQCICIAIDSYYDPERKAHYCCTTGGKKMTNIKVYDWVQQVEQLGAGELLVTSMGHDGM
    Newman          GRQCICIAIDSYYDPERKAHYCCTTGGKKMTNIKVYDWVQQVEQLGAGELLVTSMGHDGM
    USA300_FPR3757  GRQCICIAIDSYYDPERKAHYCCTTGGKKMTNIKVYDWVQQVEQLGAGELLVTSMGHDGM
                    ************************ ***********************************

    COL             KQGFDIEHLANIKSLVNIPIIASGGGGNAQHFVELFDQTDVSAGLAASILHDRETTVQSI
    N315            KQGFDIEHLAKIKSLVNIPIIASGGGGNAQHFVELFNQTDVSAGLAASILHDRETTVQSI
    NCTC8325        KQGFDIEHLANIKSLVNIPIIASGGGGNAQHFVELFDQTDVSAGLAASILHDRETTVQSI
    Newman          KQGFDIEHLANIKSLVNIPIIASGGGGNAQHFVELFDQTDVSAGLAASILHDRETTVQSI
    USA300_FPR3757  KQGFDIEHLANIKSLVNIPIIASGGGGNAQHFVELFDQTDVSAGLAASILHDRETTVQSI
                    **********:*************************:***********************

    COL             KEVIRQGGIAVR
    N315            KEVIRQGGIAVR
    NCTC8325        KEVIRQGGIAVR
    Newman          KEVIRQGGIAVR
    USA300_FPR3757  KEVIRQGGIAVR
                    ************