From AureoWiki
Jump to: navigation, search
04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 27-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SAP012 [new locus tag: SA_RS00050 ]
  • pan locus tag?:
  • symbol: blaI
  • pan gene symbol?:
  • synonym:
  • product: penicillinase repressor

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAP012 [new locus tag: SA_RS00050 ]
  • symbol: blaI
  • product: penicillinase repressor
  • replicon: pN315
  • strand: +
  • coordinates: 10644..11024
  • length: 381
  • essential: unknown

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGACCAATAAGCAAGTTGAAATATCTATGGCTGAATGGGATGTTATGAATATAATATGG
    GATAAAAAATCAGTATCAGCTAATGAAATTGTAGTTGAAATTCAAAAATATAAAGAAGTT
    AGTGATAAAACGATTAGAACATTAATCACAAGACTATATAAAAAAGAGATTATAAAACGA
    TACAAATCAGAAAATATTTATTTTTACTCATCAAATATTAAAGAAGACGATATTAAAATG
    AAAACTGCTAAAACCTTTCTTAATAAACTGTATGGAGGGGATATGAAAAGTTTAGTGCTG
    AATTTTGCGAAAAATGAAGAATTAAATAACAAAGAAATTGAAGAATTGCGAGACATTTTA
    AATGATATTAGTAAAAAGTAA
    60
    120
    180
    240
    300
    360
    381

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAP012 [new locus tag: SA_RS00050 ]
  • symbol: BlaI
  • description: penicillinase repressor
  • length: 126
  • theoretical pI: 9.4886
  • theoretical MW: 14964.2
  • GRAVY: -0.639683

Function[edit source | edit]

  • TIGRFAM:
    MetabolismTransport and binding proteinsCations and iron carrying compoundscopper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 76.1)
    Signal transductionRegulatory functionsDNA interactionscopper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 76.1)
    and 1 more
    Genetic information processingTranscriptionDNA-dependent RNA polymeraseDNA-directed RNA polymerase delta subunit (TIGR04567; EC 2.7.7.6; HMM-score: 16.1)
  • TheSEED:  
    Phages, Prophages, Transposable elements, PlasmidsTransposable elementsTn552 Beta-lactamase repressor BlaI 
    and 1 more
    Virulence, Disease and DefenseResistance to antibiotics and toxic compoundsBeta-lactamase Beta-lactamase repressor BlaI 
  • PFAM:
    HTH (CL0123) Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 119.9)
    and 4 more
    MarR; MarR family (PF01047; HMM-score: 27.2)
    PDDEXK (CL0236) RNA_pol_Rpb5_N; RNA polymerase Rpb5, N-terminal domain (PF03871; HMM-score: 14)
    HTH (CL0123) Trans_reg_C; Transcriptional regulatory protein, C terminal (PF00486; HMM-score: 12.9)
    HTH_DeoR; DeoR-like helix-turn-helix domain (PF08220; HMM-score: 11.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effector: BlaR (sensor histidine kinase) sensing beta-lactam antibiotics
  • genes regulated by BlaI, TF important in Beta-lactam resistanceRegPrecise
    repression
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.114
    • Ymax_pos: 28
    • Cmax: 0.156
    • Cmax_pos: 28
    • Smax: 0.108
    • Smax_pos: 22
    • Smean: 0.075
    • D: 0.099
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTNKQVEISMAEWDVMNIIWDKKSVSANEIVVEIQKYKEVSDKTIRTLITRLYKKEIIKRYKSENIYFYSSNIKEDDIKMKTAKTFLNKLYGGDMKSLVLNFAKNEELNNKEIEELRDILNDISKK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: BlaI (repression) regulon
    BlaI(TF)important in Beta-lactam resistance;RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]