Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 27-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SAP016 [new locus tag: SA_RS00070 ]
  • pan locus tag?:
  • symbol: arsR
  • pan gene symbol?:
  • synonym:
  • product: arsenical resistance operon repressor

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAP016 [new locus tag: SA_RS00070 ]
  • symbol: arsR
  • product: arsenical resistance operon repressor
  • replicon: pN315
  • strand: +
  • coordinates: 14107..14421
  • length: 315
  • essential: unknown

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGTCTTATAAAGAACTATCAACAATATTAAAAATTTTATCAGATCCAAGTAGGTTAGAA
    ATATTAGATTTACTTTCTTGTGGTGAGCTATGCGCTTGTGACTTATTAGAACACTTTCAA
    TTCTCACAACCTACACTAAGTCATCATATGAAGTCATTAGTAGATAATGAATTAGTTACA
    ACACGAAAAGATGGCAATAAACATTGGTATCAACTTAATCATGCTATTTTAGATGATATT
    ATCCAAAACTTGAACATCATTAATACATCTAATCAAAGATGTGTATGTAAAAATGTGAAA
    TCAGGTGACTGTTGA
    60
    120
    180
    240
    300
    315

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAP016 [new locus tag: SA_RS00070 ]
  • symbol: ArsR
  • description: arsenical resistance operon repressor
  • length: 104
  • theoretical pI: 6.3292
  • theoretical MW: 11873.6
  • GRAVY: -0.246154

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCations and iron carrying compoundscopper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 14.9)
    Signal transductionRegulatory functionsDNA interactionscopper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 14.9)
    Signal transductionRegulatory functionsDNA interactionsCRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 13.3)
    Cellular processesCellular processesToxin production and resistanceTOMM system kinase/cyclase fusion protein (TIGR03903; HMM-score: 10.1)
  • TheSEED:  
    Virulence, Disease and DefenseResistance to antibiotics and toxic compoundsArsenic resistance Arsenical resistance operon repressor 
  • PFAM:
    HTH (CL0123) HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 58)
    HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 45)
    MarR_2; MarR family (PF12802; HMM-score: 18.9)
    F-box (CL0271) F-box; F-box domain (PF00646; HMM-score: 16.1)
    HTH (CL0123) TFIIE_alpha; TFIIE alpha subunit (PF02002; HMM-score: 15.7)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 15.5)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 14.1)
    RP-C; Replication protein C N-terminal domain (PF03428; HMM-score: 13.7)
    MarR; MarR family (PF01047; HMM-score: 13.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.131
    • Ymax_pos: 33
    • Cmax: 0.116
    • Cmax_pos: 33
    • Smax: 0.187
    • Smax_pos: 1
    • Smean: 0.139
    • D: 0.134
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 16119216 NCBI
  • RefSeq: NP_395552 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MSYKELSTILKILSDPSRLEILDLLSCGELCACDLLEHFQFSQPTLSHHMKSLVDNELVTTRKDGNKHWYQLNHAILDDIIQNLNIINTSNQRCVCKNVKSGDC

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: ArsR
    ArsR (TF) important in Arsenic resistance  RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]